DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp-1.1

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_872025.1 Gene:plpp-1.1 / 173734 WormBaseID:WBGene00018756 Length:385 Species:Caenorhabditis elegans


Alignment Length:320 Identity:81/320 - (25%)
Similarity:131/320 - (40%) Gaps:71/320 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 NSNAKLSDAV-DVVLRVLLVITFFKL-ETMTAFKREIH-EEELWLYKNPRRPDIVRGGELLFWVI 125
            |:..::|..: |.::..|:.|..:.. |.:...:|..: ::|...|  |.|...|....|:...:
 Worm     4 NNTIRMSRVLCDFLVLTLIAIPLYVFHEFIPPVRRGFYCDDESIRY--PFRDSKVTRQMLIVVGL 66

  Fly   126 VAPFLVTIAFYWYTRDRRDFRAASWA------------------------------WTLALCMNG 160
            :.|.|:.:|       ...||..:|.                              :.:.:|.|.
 Worm    67 LIPILLILA-------TELFRTLAWEKKCETEFKTYHVRNHSVHRLVVRLYCFIGYFFVGVCFNQ 124

  Fly   161 IPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGL-PGDINEGRKSFPSGHS 224
            :...:.|.|:||.||.:...|.||   :...|.:..|..|.||.||.. ...|:|.:.||.||||
 Worm   125 LMVDIAKYTIGRQRPHFMDVCRPD---IGYQTCSQPDLYITDFKCTTTDTKKIHEAQLSFYSGHS 186

  Fly   225 SFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFI---ALLVAVSRTCDYHHHWQDVTI 286
            :|:|.:..|.:.|:.|:|.      |....||.:.||...:   |..|:::|..||.|||.||.:
 Worm   187 AFSFYAAWFTSLYLQARLF------RPLFSRLLLPVIQFLLFGGAAYVSLTRVSDYKHHWSDVLV 245

  Fly   287 GGLIG--------LFAGYISYTQYYPSIFC-PDAGIPLVRWPSREGSQYQRLSGKDDNGS 337
            |.::|        ||...:...:..||  | |.....|:|....:|     :|..:.|||
 Worm   246 GAIMGSAIGVFVALFVAEVFKRREIPS--CGPSNEFGLIRMDRPDG-----VSNANGNGS 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 62/239 (26%)
plpp-1.1NP_872025.1 PAP2_wunen 108..258 CDD:239479 49/158 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100228
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3374
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.