DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plpp4

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_002937854.2 Gene:plpp4 / 100487728 XenbaseID:XB-GENE-6051164 Length:271 Species:Xenopus tropicalis


Alignment Length:238 Identity:107/238 - (44%)
Similarity:149/238 - (62%) Gaps:26/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 LRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGEL---LFWVIVAPFLVTIAFYWY 138
            :|:||...|...|.:..|:|.|..||:||||||    :|:...:   |.:.|  .||..:|..:.
 Frog    10 IRLLLFGVFVFTEFLDPFQRVIQPEEIWLYKNP----LVQSDNIPTRLMFAI--SFLTPLAVIFV 68

  Fly   139 TR-----DRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTTSNGVDT 198
            .:     ||.:.:.|..|.:|||.:||:.|:.:|:.|||||||:|||||||||      ||.   
 Frog    69 VKIILRTDRTEVKEACLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDGV------SNE--- 124

  Fly   199 SILDFNCTGLPGDINEGRKSFPSGHSSFAFASFGFIAYYIGAKLHAFDSRGRGHTWRLCIAVIPL 263
               :.:|||....::||||||||.|||||||..||.::|:..|||.|...|:|.:||||.|::||
 Frog   125 ---EMHCTGDASLVSEGRKSFPSIHSSFAFAGLGFTSFYLAGKLHCFTELGQGKSWRLCAAILPL 186

  Fly   264 FIALLVAVSRTCDYHHHWQDVTIGGLIGLFAGYISYTQYYPSI 306
            :.|:::|:||.|||.|||||..:||:|||...|:.|.|:||.:
 Frog   187 YCAMMIALSRMCDYKHHWQDSFVGGVIGLILAYLCYRQHYPPL 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 94/205 (46%)
plpp4XP_002937854.2 PAP2_containing_1_like 37..225 CDD:239484 94/205 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3443
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 220 1.000 Inparanoid score I3461
OMA 1 1.010 - - QHG50067
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 1 1.000 - - FOG0001532
OrthoInspector 1 1.000 - - otm49236
Panther 1 1.100 - - O PTHR10165
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X622
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.