DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and plppr2

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_031755301.1 Gene:plppr2 / 100485784 XenbaseID:XB-GENE-6031106 Length:358 Species:Xenopus tropicalis


Alignment Length:254 Identity:59/254 - (23%)
Similarity:96/254 - (37%) Gaps:47/254 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKN------PRRPDIVRGGELLFWVIVA--PF 129
            |::||....||..:..|....|  .:|.:..:.|.:      |......|....|.:.::|  |.
 Frog    34 VELVLMAGTVILSYHFEYTDTF--PVHNQGFFCYDSTLSKPYPGPESTSRAPPRLLYPLIAILPI 96

  Fly   130 L---------VTIAFYWYTRDR--------------RDFRAASWAWTLALCMNGIPTSVLKITVG 171
            |         |.|...|.:|:|              |........::..|....|....::...|
 Frog    97 LTILVGEVTSVLIDPRWKSRERVIACGDCCFFNPLLRRIVRILGLFSFGLFCTVIFAGAVQTVTG 161

  Fly   172 RPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFN----CTGLPGDINEGRKSFPSGHSSFAFASFG 232
            ...|.:...|.|      |.|:.|..:.|...:    |||.|..|.|.||:|||..::....:..
 Frog   162 NQTPHFLSVCRP------NYTALGCMSHIQYVSSPRACTGDPDLIAEARKAFPSKPAALGAYAAV 220

  Fly   233 FIAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIG 291
            :...|:...|....||....:  ||.|:  |..:.|:::.|..:|.:||:||..|.::|
 Frog   221 YTTMYVTLVLRIKGSRLVKPS--LCFAI--LSPSWLLSLLRVAEYRNHWRDVLAGTVVG 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 51/223 (23%)
plppr2XP_031755301.1 PAP2_wunen 134..283 CDD:239479 38/152 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1621899at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.