DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and sgpp2

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001373215.1 Gene:sgpp2 / 100330698 ZFINID:ZDB-GENE-120221-2 Length:415 Species:Danio rerio


Alignment Length:336 Identity:65/336 - (19%)
Similarity:104/336 - (30%) Gaps:126/336 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTASKEGQESRRTLSDSSAEDVRNTGSRTRTNDDEMWRNELAMNTDSSSVQPEKREE---RSHRT 62
            :.|:...:|:..|.....||.|.| |||...::.         |..|:::|.:.:.|   |.|. 
Zfish    38 VNANGSVKETPVTTHRRKAEQVAN-GSRAHDSNS---------NYKSANLQNDNKVEGHPRPHY- 91

  Fly    63 GNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGELLFWVIVA 127
                        ||...|....|....|:                          |..:|::...
Zfish    92 ------------VVKNWLFYFLFVTSATL--------------------------GHEIFYITFL 118

  Fly   128 PFLVTIAFYWYTRDRRDFRAASWAWTLALCMNGIPTSVLKITVGRPRPDYFYRCFPDGVMVLNTT 192
            |     ..:| ..|....|.....|.:.:.:..:...|||:    |||       |...:|    
Zfish   119 P-----CIHW-NLDPFLCRRLVNMWVVVMYIGQVMKDVLKL----PRP-------PSPPVV---- 162

  Fly   193 SNGVDTSILDFNCTGLPGDINEGRKSFPSGHSSFAFA-SFGFI---------AYYIGAKLHAFDS 247
              .::|.:             :.....||.|:..|.| ||..:         .:.:|        
Zfish   163 --KLETRV-------------DAEYGMPSTHAMAATAISFTLLLSAEERVQFPFELG-------- 204

  Fly   248 RGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHWQDVTIGGLIGLFA--------GYISYTQYYP 304
                    |.:||:   :::||.:||.....|...||..|..|..|.        |.|.|.|.:.
Zfish   205 --------LAVAVL---MSVLVCLSRLYTGMHSALDVICGVAISAFIIAVSYPYWGTIDYLQLHN 258

  Fly   305 SIFCPDAGIPL 315
            .: .|..|:.|
Zfish   259 PV-APVVGMVL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 40/215 (19%)
sgpp2NP_001373215.1 PAP2_SPPase1 96..243 CDD:239482 40/227 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.