DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12746 and sgpp1b

DIOPT Version :9

Sequence 1:NP_649551.4 Gene:CG12746 / 40672 FlyBaseID:FBgn0037341 Length:363 Species:Drosophila melanogaster
Sequence 2:XP_001343219.1 Gene:sgpp1b / 100003745 ZFINID:ZDB-GENE-090319-2 Length:437 Species:Danio rerio


Alignment Length:344 Identity:69/344 - (20%)
Similarity:101/344 - (29%) Gaps:145/344 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GQESRRTLSDSSAEDVRNTGSRTRTND------DEMWRNELAMNTDSSSVQPEKRE--------- 56
            |.::|        :.|||....||:.|      |...|.:....||:     |||.         
Zfish    33 GSDTR--------DSVRNGVQGTRSGDVHNGGGDATRRRKAGAETDT-----EKRNNGLANGTAG 84

  Fly    57 ERSHRTGNSNAKLSDAVDVVLRVLLVITFFKLETMTAFKREIHEEELWLYKNPRRPDIVRGGEL- 120
            |..:...|.:..|..||....|..|        |..|.:..:.|.:...|.      ...|.|| 
Zfish    85 ENVNGDNNGHDALGSAVKPSRRNSL--------TGDAGQEFLIENKFLFYL------FTLGTELG 135

  Fly   121 --LFWVIVAPFLVTIAFYW----YTRDRRDFRAASWAWTLAL--CMNGI-----PTS--VLKITV 170
              ||::...||     |.|    |...|   ....|.|.:.|  |...:     |.|  |:|:  
Zfish   136 NELFYISFFPF-----FMWNVDAYVSRR---LVVVWVWVMYLGQCTKDVFRWPRPASPPVVKV-- 190

  Fly   171 GRPRPDYFYRCFPDGVMVLNTTSNGVDTSILDFNCTGLPGDINEGRKSFPSGH--SSFAFASFGF 233
                 :.||                                  ....|.||.|  |..|.....|
Zfish   191 -----EMFY----------------------------------NSEYSMPSTHAMSGTAIPLSLF 216

  Fly   234 IAYYIGAKLHAFDSRGRGHTWRLCIAVIPLFIALLVAVSRTCDYHHHW------QDVTIG--GLI 290
            :..|           ||   |.     .|:.:.|.:|:|        |      ..:.:|  .::
Zfish   217 LLTY-----------GR---WE-----YPMLLGLSLAIS--------WCVLVCLSRIYMGMHSIL 254

  Fly   291 GLFAGYISYTQYYPSIFCP 309
            .:.||:: |:.....:|.|
Zfish   255 DIIAGFL-YSLLILVVFSP 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12746NP_649551.4 PAP2_containing_1_like 104..302 CDD:239484 42/223 (19%)
sgpp1bXP_001343219.1 PgpB 109..280 CDD:223743 48/255 (19%)
PAP2_SPPase1 122..270 CDD:239482 42/230 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0671
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.