DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYN and LSB1

DIOPT Version :9

Sequence 1:XP_011515831.1 Gene:LYN / 4067 HGNCID:6735 Length:682 Species:Homo sapiens
Sequence 2:NP_011652.1 Gene:LSB1 / 853037 SGDID:S000003368 Length:241 Species:Saccharomyces cerevisiae


Alignment Length:114 Identity:34/114 - (29%)
Similarity:54/114 - (47%) Gaps:26/114 - (22%)


- Green bases have known domain annotations that are detailed below.


Human   213 ERVPESQLLPGQRFQ---TKDPE------------EQGDIVVALYPYDGIHPDDLSFKKGEKMKV 262
            |.:.||.::.|..|:   :|.||            :..:.|.|||.::.....|||.|.|:|::|
Yeast    18 EFLKESNVISGDIFELINSKLPEKWDGNQRSPQNADTEEYVEALYDFEAQQDGDLSLKTGDKIQV 82

Human   263 LEE-HGEWWKAKSLLTKKEGFIPSNYVAKLNTLETEEWFFKDITRKDAE 310
            ||: ..:|::.||  ..|.|..|:|||        :..|.:..:.|.||
Yeast    83 LEKISPDWYRGKS--NNKIGIFPANYV--------KPAFTRSASPKSAE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYNXP_011515831.1 SH3_Lyn 237..292 CDD:212937 22/55 (40%)
SH2_Src_Lyn 295..395 CDD:198227 4/16 (25%)
PTKc_Lyn 409..680 CDD:270657
Pkinase_Tyr 417..667 CDD:285015
LSB1NP_011652.1 SH3 55..108 CDD:214620 22/62 (35%)
PRK14971 <100..>156 CDD:237874 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.