DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYN and skb5

DIOPT Version :9

Sequence 1:XP_011515831.1 Gene:LYN / 4067 HGNCID:6735 Length:682 Species:Homo sapiens
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:137 Identity:28/137 - (20%)
Similarity:50/137 - (36%) Gaps:44/137 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   186 VLLGRPVAPPTLNSSHRGAPPPRNFHRERVPESQLLPGQRF---------QTKDPEEQGD----- 236
            :::||....|..:..|.|      ||...:.|.:    :||         :..|..|..|     
pombe    10 LVVGRDYLYPPDHELHYG------FHARVIEEEE----ERFVDDTFDETIEGSDDSESIDDTEVF 64

Human   237 -------------------IVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWK-AKSLLTKKEG 281
                               ..||||.::.:|.::|.|..|:::.:|.|..:.|. |....:.:.|
pombe    65 YDAEESESTHPSASFNVLADAVALYDFEPLHDNELGFTTGQRLCILSESSDGWLIAYDDASGRSG 129

Human   282 FIPSNYV 288
            .:|..:|
pombe   130 LVPETFV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYNXP_011515831.1 SH3_Lyn 237..292 CDD:212937 15/53 (28%)
SH2_Src_Lyn 295..395 CDD:198227
PTKc_Lyn 409..680 CDD:270657
Pkinase_Tyr 417..667 CDD:285015
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 15/53 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 42 1.000 Domainoid score I4126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.