DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snm1 and pot-2

DIOPT Version :10

Sequence 1:NP_649548.1 Gene:Snm1 / 40669 FlyBaseID:FBgn0037338 Length:763 Species:Drosophila melanogaster
Sequence 2:NP_497017.1 Gene:pot-2 / 175110 WormBaseID:WBGene00010195 Length:251 Species:Caenorhabditis elegans


Alignment Length:48 Identity:11/48 - (22%)
Similarity:22/48 - (45%) Gaps:15/48 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   538 SYGKRISTIGIEYSEHSSYKEL--------------ERFVRFLKPKRV 571
            ||.:.|:|:.::: ||.:::..              |.|..|.:|:.|
 Worm   144 SYQRGITTVPVDF-EHEAFQNFKKKVEAVLETVAYDENFTEFQQPEEV 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snm1NP_649548.1 SNM1A-1C-like_MBL-fold 252..408 CDD:293831
DRMBL 481..578 CDD:429512 11/48 (23%)
pot-2NP_497017.1 POT1PC 19..174 CDD:435514 6/30 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.