DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and pcmt1

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001025616.1 Gene:pcmt1 / 595004 XenbaseID:XB-GENE-959017 Length:228 Species:Xenopus tropicalis


Alignment Length:223 Identity:129/223 - (57%)
Similarity:163/223 - (73%) Gaps:5/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMH 65
            |||:|.||::.:|:..|:.:|:|.||.|.:.|.||||:||:..|||||:||.||...||||||||
 Frog     1 MAWKSGGASHSELVNNLRKNGIIKSDRVFEVMLETDRRHYAKCNPYMDSPQSIGYQATISAPHMH 65

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNT 130
            |:|||.|.|.|..||:.||||||||.|||||.|.:..||     ::|||:|..|||..|..|:..
 Frog    66 AYALELLHDQLHEGAKALDVGSGSGILTACFSRMVGPKG-----KVVGIDHIKELVDDSINNVKK 125

  Fly   131 DDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQ 195
            ||.::|.||::.::.||||.|||..|||:|||||||||..|..||:||..|||||:||||.||:|
 Frog   126 DDTTLLSSGRVKLLVGDGRMGYPEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQ 190

  Fly   196 YMQQYDKDANGKVEMTRLMGVMYVPLTD 223
            .::||||..:|.|:|..||||:||||||
 Frog   191 MLEQYDKLDDGSVKMKPLMGVIYVPLTD 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 120/212 (57%)
AdoMet_MTases 13..223 CDD:302624 121/209 (58%)
pcmt1NP_001025616.1 PCMT 8..216 CDD:250389 120/212 (57%)
AdoMet_MTases 13..220 CDD:302624 123/211 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2137
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55895
Inparanoid 1 1.050 257 1.000 Inparanoid score I3063
OMA 1 1.010 - - QHG53644
OrthoDB 1 1.010 - - D1138104at2759
OrthoFinder 1 1.000 - - FOG0002960
OrthoInspector 1 1.000 - - otm47677
Panther 1 1.100 - - O PTHR11579
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.