DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and pcmtd2a

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001035010.1 Gene:pcmtd2a / 556012 ZFINID:ZDB-GENE-060312-14 Length:376 Species:Danio rerio


Alignment Length:231 Identity:54/231 - (23%)
Similarity:104/231 - (45%) Gaps:31/231 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMD-----APQPIG---GGVTISA 61
            |.|.:|::||..||:...|.|:.|..|.:..||..|     |::     |.:.:.   |.:.:||
Zfish     6 SAGEDNDELIDNLKEAQYIRSNLVEHAFRAIDRADY-----YLEEFRDSAYKDLAWRHGNIHLSA 65

  Fly    62 PHMHAFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKA 126
            |.:::..:|.|  .|:||...|::|||:|||:......:...||:.     |:|...:::..:..
Zfish    66 PCIYSEVMEAL--DLQPGLSFLNLGSGTGYLSTMVGLILGPFGVNH-----GVELHEDVIEYAYQ 123

  Fly   127 NLN-----TDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLAS-GGRLI 185
            .|:     .|.....|..:...|.|:..:..|.:..|:.::.||.......:.:.:|.. ||.|:
Zfish   124 KLDFFIKTNDSFDRFDFCEPSFVVGNCLEIAPESRQYDRVYCGAGVQREHEDYMKKLLKIGGILV 188

  Fly   186 VPVGPDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL 221
            :|:     .:.:.:..:......|..:::.|.:.||
Zfish   189 LPL-----EEKLTKITRTGYNTWETRKIIAVSFAPL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 50/226 (22%)
AdoMet_MTases 13..223 CDD:302624 51/223 (23%)
pcmtd2aNP_001035010.1 AdoMet_MTases 7..>126 CDD:302624 35/130 (27%)
PCMT 11..219 CDD:250389 50/224 (22%)
Methyltransf_18 80..189 CDD:289607 26/113 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2518
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.