DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and PCMT1

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001238978.1 Gene:PCMT1 / 5110 HGNCID:8728 Length:286 Species:Homo sapiens


Alignment Length:223 Identity:125/223 - (56%)
Similarity:159/223 - (71%) Gaps:5/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMH 65
            |||:|.||::.:||..|:.:|:|.:|.|.:.|..|||.||:..|||||:||.||...||||||||
Human    59 MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKCNPYMDSPQSIGFQATISAPHMH 123

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNT 130
            |:|||.|.|.|..||:.||||||||.|||||.|.:...|     :::||:|..|||..|..|:..
Human   124 AYALELLFDQLHEGAKALDVGSGSGILTACFARMVGCTG-----KVIGIDHIKELVDDSVNNVRK 183

  Fly   131 DDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQ 195
            ||.::|.||::.:|.||||.||...|||:|||||||||..|..||:||..|||||:||||.||:|
Human   184 DDPTLLSSGRVQLVVGDGRMGYAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLILPVGPAGGNQ 248

  Fly   196 YMQQYDKDANGKVEMTRLMGVMYVPLTD 223
            .::||||..:|.::|..||||:||||||
Human   249 MLEQYDKLQDGSIKMKPLMGVIYVPLTD 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 116/212 (55%)
AdoMet_MTases 13..223 CDD:302624 117/209 (56%)
PCMT1NP_001238978.1 PCMT 66..274 CDD:250389 116/212 (55%)
AdoMet_MTases 71..278 CDD:302624 119/211 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145654
Domainoid 1 1.000 235 1.000 Domainoid score I2384
eggNOG 1 0.900 - - E1_COG2518
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H55895
Inparanoid 1 1.050 248 1.000 Inparanoid score I3260
Isobase 1 0.950 - 0 Normalized mean entropy S2607
OMA 1 1.010 - - QHG53644
OrthoDB 1 1.010 - - D1138104at2759
OrthoFinder 1 1.000 - - FOG0002960
OrthoInspector 1 1.000 - - oto88667
orthoMCL 1 0.900 - - OOG6_100731
Panther 1 1.100 - - O PTHR11579
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R925
SonicParanoid 1 1.000 - - X2315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1615.790

Return to query results.
Submit another query.