DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and Pcmtd2

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_001101280.2 Gene:Pcmtd2 / 311726 RGDID:1305684 Length:359 Species:Rattus norvegicus


Alignment Length:227 Identity:59/227 - (25%)
Similarity:104/227 - (45%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHY----SPRNPYMDAPQPIGGGVTISAPHMH 65
            |.|.:|::||..||:...|.:|.|.||.:..||..|    ...|.|.|.... .|.:.:|||.::
  Rat     6 SAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEEFKENAYKDLAWK-HGNIHLSAPCIY 69

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLN- 129
            :..:|.|  .|:||...|::|||:|||::.....:...||:.     |:|..:::...:|..|: 
  Rat    70 SEVMEAL--DLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNH-----GVELHSDVTEYAKQKLDV 127

  Fly   130 ----TDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELI-NQLASGGRLIVPVG 189
                :|.....|..:...|.|:..:..|....|:.::.||.......|.: |.|..||.|::|: 
  Rat   128 FIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPL- 191

  Fly   190 PDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL 221
                .:.:.:..:......|..:::.|.:.||
  Rat   192 ----EEKLTKITRTGPSAWETKKILAVSFAPL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 55/222 (25%)
AdoMet_MTases 13..223 CDD:302624 56/219 (26%)
Pcmtd2NP_001101280.2 PCMT 11..219 CDD:395902 55/220 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2518
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.