DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and Pcmtd2

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_006500683.1 Gene:Pcmtd2 / 245867 MGIID:1923927 Length:382 Species:Mus musculus


Alignment Length:194 Identity:55/194 - (28%)
Similarity:92/194 - (47%) Gaps:18/194 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHY----SPRNPYMDAPQPIGGGVTISAPHMH 65
            |.|.:|::||..||:...|.:|.|.||.:..||..|    ...|.|.|.... .|.:.:|||.::
Mouse     6 SAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEEFKENAYKDLAWK-HGNIHLSAPCIY 69

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLN- 129
            :..:|.|  .|:||...|::|||:|||::.....:...||:.     |:|..:::...:|..|: 
Mouse    70 SEVMEAL--DLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNH-----GVELHSDVTEYAKQKLDV 127

  Fly   130 ----TDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELI-NQLASGGRLIVPV 188
                :|.....|..:...|.|:..:..|....|:.::.||.......|.: |.|..||.|::|:
Mouse   128 FIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPL 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 53/191 (28%)
AdoMet_MTases 13..223 CDD:302624 52/186 (28%)
Pcmtd2XP_006500683.1 PCMT 11..214 CDD:395902 53/189 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2518
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.