DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and PCMTD1

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:NP_443169.2 Gene:PCMTD1 / 115294 HGNCID:30483 Length:357 Species:Homo sapiens


Alignment Length:227 Identity:60/227 - (26%)
Similarity:102/227 - (44%) Gaps:23/227 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPR----NPYMDAPQPIGGGVTISAPHMH 65
            |.|.:|:|||..||:...|.::.|.||.:..||..|...    |.|.|.... .|.:.:|||.::
Human     6 SAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWK-HGNIHLSAPCIY 69

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANL-- 128
            :..:|.|:  |:||...|::|||:|||:......:...|::.     |||..:::|..:|..|  
Human    70 SEVMEALK--LQPGLSFLNLGSGTGYLSTMVGLILGPFGINH-----GIELHSDVVEYAKEKLES 127

  Fly   129 ---NTDDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAA-PDTPTELINQLASGGRLIVPVG 189
               |:|.....:..:...|.|:..:....:..|:.|:.||.. .|....:...|..||.|::|: 
Human   128 FIKNSDSFDKFEFCEPAFVVGNCLQIASDSHQYDRIYCGAGVQKDHENYMKILLKVGGILVMPI- 191

  Fly   190 PDGGSQYMQQYDKDANGKVEMTRLMGVMYVPL 221
                ...:.|..:......|...::.|.:.||
Human   192 ----EDQLTQIMRTGQNTWESKNILAVSFAPL 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 56/222 (25%)
AdoMet_MTases 13..223 CDD:302624 56/219 (26%)
PCMTD1NP_443169.2 PCMT 11..220 CDD:366483 58/222 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..333
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.