DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pcmt and XB5997770

DIOPT Version :9

Sequence 1:NP_536756.1 Gene:Pcmt / 40668 FlyBaseID:FBgn0086768 Length:226 Species:Drosophila melanogaster
Sequence 2:XP_012823568.1 Gene:XB5997770 / 100216173 XenbaseID:XB-GENE-5997771 Length:265 Species:Xenopus tropicalis


Alignment Length:223 Identity:124/223 - (55%)
Similarity:152/223 - (68%) Gaps:5/223 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAWRSVGANNEDLIRQLKDHGVIASDAVAQAMKETDRKHYSPRNPYMDAPQPIGGGVTISAPHMH 65
            |||.|.|..:.||:..|:.:.||.|..|...:..|||.||....||||:||.||...||||||||
 Frog    38 MAWTSTGKTHADLVNNLRKNSVIKSQHVYDILLATDRAHYIQYFPYMDSPQSIGYKATISAPHMH 102

  Fly    66 AFALEYLRDHLKPGARILDVGSGSGYLTACFYRYIKAKGVDADTRIVGIEHQAELVRRSKANLNT 130
            |.|||.|.|.|..||:.||||||||||||||.|.:...|     ::|||||...||:.:..|:..
 Frog   103 AHALELLEDKLVEGAKALDVGSGSGYLTACFARMVGLTG-----KVVGIEHINHLVKDAVQNVKQ 162

  Fly   131 DDRSMLDSGQLLIVEGDGRKGYPPNAPYNAIHVGAAAPDTPTELINQLASGGRLIVPVGPDGGSQ 195
            ||.::|.:|::..|.||||.|||.:.||:||||||||...|.||:.||..||||::||||:||||
 Frog   163 DDPALLSNGRIKFVVGDGRLGYPEDGPYDAIHVGAAAATVPQELLKQLKPGGRLVLPVGPEGGSQ 227

  Fly   196 YMQQYDKDANGKVEMTRLMGVMYVPLTD 223
            .::|||||:.||:...||||||||||||
 Frog   228 VLEQYDKDSEGKITRVRLMGVMYVPLTD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PcmtNP_536756.1 PCMT 8..221 CDD:250389 115/212 (54%)
AdoMet_MTases 13..223 CDD:302624 116/209 (56%)
XB5997770XP_012823568.1 PCMT 46..258 CDD:366483 119/215 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 245 1.000 Domainoid score I2137
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 257 1.000 Inparanoid score I3063
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1138104at2759
OrthoFinder 1 1.000 - - FOG0002960
OrthoInspector 1 1.000 - - otm47677
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2315
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.060

Return to query results.
Submit another query.