DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdar1 and Ir7d

DIOPT Version :9

Sequence 1:NP_730940.1 Gene:Nmdar1 / 40665 FlyBaseID:FBgn0010399 Length:997 Species:Drosophila melanogaster
Sequence 2:NP_001138175.1 Gene:Ir7d / 7354416 FlyBaseID:FBgn0259190 Length:594 Species:Drosophila melanogaster


Alignment Length:258 Identity:58/258 - (22%)
Similarity:92/258 - (35%) Gaps:82/258 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   472 LLIELSKRINFTYDLALS-PDGQFGHYILRNNTGAMTLRKEWTGLIGELVNERADMIVAPLTINP 535
            ||..:::::|||..|..: |:|..|.....|.|        :||....|...||::.:......|
  Fly   243 LLRIVARKMNFTLKLIPNEPNGLIGGSSFMNGT--------FTGAYKMLRERRANITIGCAACTP 299

  Fly   536 ERAEYIEFSKPFKYQGITILEKKPSRSSTLVSFLQPFSNTLWILVMVSVHVVALVLYLLDRFSPF 600
            ||:.::|.:.|:......|:.:.....|.....|.||....|:|                     
  Fly   300 ERSTFLEATSPYSQMSYIIVLQARGGYSIYEVMLFPFEKYTWLL--------------------- 343

  Fly   601 GRFKLSHSDSNEEKALNLSSAVWFAWGVLLNSGIGEGTPRSFSARVLG--MVWAGFAMIIVASYT 663
                             ||:.:...|.|        |:.....:.:|.  |:|   ..:|.|||.
  Fly   344 -----------------LSTILGLHWIV--------GSRWRMPSPILAGWMLW---IFVIRASYE 380

  Fly   664 ANLAAFL----VLERPKT---KLSG----IND-ARLRNTM-------ENLTCATVKGSSVDMY 707
            |::..|:    |...|:|   .|||    |.| |..|.|:       :.|..|   |..||::
  Fly   381 ASVFNFIQNSPVKPSPRTLDQALSGGFRFITDHASYRMTLKIPSFQGKTLISA---GQPVDVF 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmdar1NP_730940.1 PBP1_iGluR_NMDA_NR1 12..405 CDD:107374
ANF_receptor 58..371 CDD:279440
PBP2_iGluR_NMDA_Nr1 417..818 CDD:270437 58/258 (22%)
HisJ 451..>558 CDD:223904 22/86 (26%)
Periplasmic_Binding_Protein_Type_2 <516..651 CDD:304360 22/136 (16%)
Lig_chan 575..838 CDD:278489 32/154 (21%)
CaM_bdg_C0 854..882 CDD:287524
Ir7dNP_001138175.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.