DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nmdar1 and Ir75a

DIOPT Version :10

Sequence 1:NP_730940.1 Gene:Nmdar1 / 40665 FlyBaseID:FBgn0010399 Length:997 Species:Drosophila melanogaster
Sequence 2:NP_649012.2 Gene:Ir75a / 39982 FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster


Alignment Length:179 Identity:41/179 - (22%)
Similarity:67/179 - (37%) Gaps:50/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   307 KERCIPQTALAEKILARSQGTLSD---LLRMPKPWSVM---------KNGRATFQRMSNWL---- 355
            ||...|..|.:.||..:..||:::   :||..:..:|:         :|...||....|.|    
  Fly    51 KEGYRPPPATSNKIHEQGNGTVAEIERILRFDQSNTVLFLFSSNSDNQNLHTTFTVERNKLVRLS 115

  Fly   356 ----GLDPDVRRALCFLPKEDVARITGL--------DEPTPAKRKKTVKVIRLTFTETQ------ 402
                ||:   |..|..|.:|:..|:..|        |.||..:|...::.:..::...:      
  Fly   116 LDNAGLE---RLELTLLGRENDCRLADLSVPRNRLRDLPTGVERLTALRKLDYSYNLLEEFKLDR 177

  Fly   403 ------LKSLQKSFQQNHRPTREMRQKLSATLELDFSTVGNFFMNSRRR 445
                  ||.|..|..:..|.....:..|:|..:||.|       |:|.|
  Fly   178 LANAAGLKQLLLSHNRLERFVATEQVNLAALHKLDLS-------NNRLR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nmdar1NP_730940.1 PBP1_iGluR_NMDA_NR1 37..405 CDD:380602 29/137 (21%)
PBP2_iGluR_NMDA_Nr1 417..818 CDD:270437 8/29 (28%)
CaM_bdg_C0 854..882 CDD:402271
Ir75aNP_649012.2 Periplasmic_Binding_Protein_Type_2 455..572 CDD:473866
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.