DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKCC and slc7a1a

DIOPT Version :9

Sequence 1:NP_730938.1 Gene:NKCC / 40663 FlyBaseID:FBgn0051547 Length:1068 Species:Drosophila melanogaster
Sequence 2:XP_021327949.1 Gene:slc7a1a / 559627 ZFINID:ZDB-GENE-091116-69 Length:651 Species:Danio rerio


Alignment Length:613 Identity:129/613 - (21%)
Similarity:212/613 - (34%) Gaps:243/613 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 ILQSLI-----IITISAVVC---------VITTLSLSAISTNGEVKGGGVYFI---ISR-SLGP- 213
            :|:.|:     ::.:..|.|         .:.|..|.|:.. |...|.|||.:   ::| :.|| 
Zfish     2 VLKKLLRFGKQLLRVKVVNCNSEESRLSRCLNTFDLVALGV-GSTLGAGVYVLAGAVARENAGPA 65

  Fly   214 --------------------EFGA--------------SVGVVFAF-----------------AN 227
                                ||||              :||.::||                 |.
Zfish    66 IVLSFLIAALASVLAGLCYAEFGARVPKTGSAYLYSYVTVGELWAFITGWNLILSYVIGTSSVAR 130

  Fly   228 AVSASMN-TIG-----FCE---SLN---VLLKNNDL----------KIVDNGINDIRIVGS---- 266
            |.||:.: .||     ||.   |:|   ||.:..|:          .::..|:.:..:|..    
Zfish   131 AWSATFDELIGKHIEHFCRQYMSMNAPGVLAEYPDMFSVFIILTLTGLLAFGVKESAMVNKVFTC 195

  Fly   267 ITVLVLILICCVGM------EWETKAQNFLIVTIVLAIFNFLIGAAIGPQGNEEQISR-GFVGFS 324
            |.:|||:.:...|:      .|.......|..|      |..:.|. .|..:||.:.: ||:.|.
Zfish   196 INILVLLFMVVSGLVKGTLKNWHLDPDEILNAT------NSTLNAT-QPLPSEEMLGQGGFMPFG 253

  Fly   325 WATLKENFGSDYRYAEGVNHDFFSVFAIFFPSVTGIQAGANICGDLKDAGAAIPKGTFWSLLISM 389
            :.              ||    .|..|..|.:..|....|....::|:...|||.|...||||  
Zfish   254 FT--------------GV----LSGAATCFYAFVGFDCIATTGEEVKNPQRAIPIGIVSSLLI-- 298

  Fly   390 SSYALFVLFAGGAAVRDASGIPADLVNGTIVSSELPCMATGNCTWGLFNSYEMMQEMSLWGPL-- 452
                .||.:.|                   ||:.|..|.          .|.|:.:.|   ||  
Zfish   299 ----CFVAYFG-------------------VSAALTMMM----------PYYMLDKNS---PLPV 327

  Fly   453 --IYAGCFAATLSTAL-------TNLLS----VPRLVQALGIDQIYPGLIF-FSKPYGKHGE-PY 502
              .|.|...||.:.|:       |:||.    :||::.|:..|    ||:| |.....:..: |.
Zfish   328 AFKYVGWEGATYAVAVGSLCALSTSLLGAMFPMPRVLWAMADD----GLLFKFMAGISERTKTPI 388

  Fly   503 RGYVLTFFITTGFLLIGELNLIAPLISTFYLASYALINFC-------------TFHAA------- 547
            :..:::.|:......:.:|..:..|:|...|.:|.|:..|             |:|.|       
Zfish   389 KATIMSGFLAAIMAFLFDLKDLVDLMSIGTLLAYTLVAACVLVLRYQPEQFSQTYHIANTHEDME 453

  Fly   548 ----------FVKPLGWRPTFKYYNAWL-------SLFGFA--MCVAIMFLI----------NYV 583
                      .:.| |....|.:.|...       :|.||.  :|.:::.|:          ..:
Zfish   454 MSETISTPSMGILP-GVEERFSFKNLLFPDIIEPSNLSGFTVNICTSLLGLLILSFSLLAVRGGI 517

  Fly   584 AA--IITFGIIFALYLVV---MYRKPEA 606
            |:  |||..::|.|.::|   ::|:||:
Zfish   518 ASWNIITLAVLFGLCVIVTFIIWRQPES 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKCCNP_730938.1 2a30 85..1068 CDD:273347 129/613 (21%)
DUF502 507..>643 CDD:294696 30/154 (19%)
SLC12 651..1068 CDD:281515
slc7a1aXP_021327949.1 2A0303 4..603 CDD:273330 128/611 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.