DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NKCC and slc12a6

DIOPT Version :9

Sequence 1:NP_730938.1 Gene:NKCC / 40663 FlyBaseID:FBgn0051547 Length:1068 Species:Drosophila melanogaster
Sequence 2:XP_009298223.2 Gene:slc12a6 / 100330290 ZFINID:ZDB-GENE-160113-148 Length:226 Species:Danio rerio


Alignment Length:327 Identity:60/327 - (18%)
Similarity:103/327 - (31%) Gaps:137/327 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 HVKNYHPQVLVLSGDPKTRPPLVDFGYLLTKNNSLMFVANIIP---------VRVGYKNRQHLVK 688
            |||:               |.|:.|...|.....|..|..:||         .....:..:||  
Zfish     5 HVKS---------------PRLLTFASQLKAGKGLTIVGTVIPGNFLHTYGEALAAEQTLKHL-- 52

  Fly   689 DGQKYLDARKIKAFYNVIDGFSLEDGINALTKSTGFGKMSPNIVLVGYKPDWNRCRKEEVESYFS 753
                 ::..::|.|...|......:||:.:.:|:|.|.|..|.|::|:...|.  :.|:.:|:.:
Zfish    53 -----MEKERVKGFVQCIVAQKPREGISHMIQSSGLGGMKHNTVVMGWPHAWR--QSEDPQSWKT 110

  Fly   754 ILYNAFSQRMGVALLRLPNGLDFSELSSEVTLPANGMGHMHTANAHGFTNELMPAANAASELLHI 818
                                                           |.|.:.....|...|| :
Zfish   111 -----------------------------------------------FINTVRVTTTAHLALL-V 127

  Fly   819 DSNLNLASMDSPNSSFTMPQPAPMPNMQRNSRSYKVTSSDEPAVTYHTKGGSDIPQNLLDAMTIF 883
            ..|::|                                               .|.| .:|.|  
Zfish   128 LKNISL-----------------------------------------------FPSN-SEACT-- 142

  Fly   884 TRKQPKGTIDVFWLYDDGGLTILLPYIISMRSHWQNSKLRVFAMCHGKDEE-QEEKSMASLLTKF 947
                 :|.||::|:..|||:.:|||:::.....|:...||:|.:...:|.. |.:|.:|:.|...
Zfish   143 -----EGFIDIWWIVHDGGMLMLLPFLLRQHKVWRKCALRIFTVAQMEDNSIQMKKDLATFLYHL 202

  Fly   948 RI 949
            ||
Zfish   203 RI 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NKCCNP_730938.1 2a30 85..1068 CDD:273347 60/327 (18%)
DUF502 507..>643 CDD:294696 3/9 (33%)
SLC12 651..1068 CDD:281515 57/309 (18%)
slc12a6XP_009298223.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.