DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and slpr

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_001188558.1 Gene:slpr / 44111 FlyBaseID:FBgn0030018 Length:1155 Species:Drosophila melanogaster


Alignment Length:369 Identity:98/369 - (26%)
Similarity:154/369 - (41%) Gaps:83/369 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 TDTHKSND--------SDKTVSLSGSASTDSDRTPVRVDSTEDGDSGQWRQNSISLKEWDIPYGD 678
            ||:..|.|        .||.........||.|...:.| |:..||          ::..:|.|.:
  Fly    75 TDSEVSGDVGWWTGKIGDKVGVFPKDFVTDEDPLQLNV-SSAIGD----------IQPHEIEYNE 128

  Fly   679 LLLLERIGQGRFGTVHRALWHG-DVAVKLLN---EDYLQDEHMLETFRSEVANFKNTRHENLVLF 739
            |.:.|.||.|.|..|||..:.| :||:|:.:   ||.:|  .|.:....|...|...:|||:...
  Fly   129 LDIKEVIGSGGFCKVHRGYYDGEEVAIKIAHQTGEDDMQ--RMRDNVLQEAKLFWALKHENIAAL 191

  Fly   740 MGACMNPPYLAIVTSLCKGNTLYTYIHQRREKFAMNRTL--------LI--AQQIAQGMGYLH-- 792
            .|.|:|.. |.:|....:|.:|             ||.|        |:  |.|||:||.|||  
  Fly   192 RGVCLNTK-LCLVMEYARGGSL-------------NRILAGKIPPDVLVNWAIQIARGMNYLHNE 242

  Fly   793 -AREIIHKDLRTKNIFI---------ENGKVIITDFGLFSSTKLLYCDMGLGVPHNWLCYLAPEL 847
             ...|||:||::.|:.|         :...:.||||||   .:.:|....:.....: .::.||:
  Fly   243 APMSIIHRDLKSSNVLIYEAIEGNHLQQKTLKITDFGL---AREMYNTQRMSAAGTY-AWMPPEV 303

  Fly   848 IRALQPEKPRGECLEFTPYSDVYSFGTVWYELICGEFTFKDQPAESIIWQVGRGMKQSLANLQSG 912
            |          ....::.:|||:|:|.:.:|||.||..:|.....|:.:    |:..:...|...
  Fly   304 I----------SVSTYSKFSDVWSYGVLLWELITGETPYKGFDPLSVAY----GVAVNTLTLPIP 354

  Fly   913 RDVKD----LLMLCWTYEKEHRPQFARLLSLLEHLPKKRLARSP 952
            :...:    |:..||..:...||.|..:|..||.:...:...:|
  Fly   355 KTCPETWGALMKSCWQTDPHKRPGFKEILKQLESIACSKFTLTP 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 82/297 (28%)
Pkinase_Tyr 679..940 CDD:285015 80/290 (28%)
slprNP_001188558.1 SH3_MLK 47..104 CDD:212809 6/28 (21%)
TyrKc 129..386 CDD:197581 80/290 (28%)
STKc_MLK 134..389 CDD:270963 80/288 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445263
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.