DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and MAP3K9

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:XP_011535090.1 Gene:MAP3K9 / 4293 HGNCID:6861 Length:1166 Species:Homo sapiens


Alignment Length:397 Identity:109/397 - (27%)
Similarity:164/397 - (41%) Gaps:84/397 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   610 GVDKRTPFTSEYTDTHKSNDSDKTVSLSGSASTDSDRTPVRVDSTEDGDSGQWR----------- 663
            |.|...|:.:...:...:.:.:.|:.|.......|.      ||...||.|.|.           
Human    49 GCDAPLPYWTAVFEYEAAGEDELTLRLGDVVEVLSK------DSQVSGDEGWWTGQLNQRVGIFP 107

  Fly   664 QNSIS---------------------LKEWDIPYGDLLLLERIGQGRFGTVHRALWHGD-VAVKL 706
            .|.::                     ::..:|.:.:|.|.|.||.|.||.|:||.|.|| ||||.
Human   108 SNYVTPRSAFSSRCQPGGEDPSCYPPIQLLEIDFAELTLEEIIGIGGFGKVYRAFWIGDEVAVKA 172

  Fly   707 LNEDYLQD-EHMLETFRSEVANFKNTRHENLVLFMGACMNPPYLAIVTSLCKGNTLYTYIHQRRE 770
            ...|..:| ...:|..|.|...|...:|.|::...|.|:..|.|.:|....:|..|...:..:| 
Human   173 ARHDPDEDISQTIENVRQEAKLFAMLKHPNIIALRGVCLKEPNLCLVMEFARGGPLNRVLSGKR- 236

  Fly   771 KFAMNRTLLI--AQQIAQGMGYLHAR---EIIHKDLRTKNIFI----ENG----KVI-ITDFGL- 820
               :...:|:  |.|||:||.|||..   .|||:||::.||.|    |||    |:: |||||| 
Human   237 ---IPPDILVNWAVQIARGMNYLHDEAIVPIIHRDLKSSNILILQKVENGDLSNKILKITDFGLA 298

  Fly   821 ---FSSTKLLYCDMGLGVPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELICG 882
               ..:||     |.....:.|   :|||:|||..          |:..|||:|:|.:.:||:.|
Human   299 REWHRTTK-----MSAAGTYAW---MAPEVIRASM----------FSKGSDVWSYGVLLWELLTG 345

  Fly   883 EFTFKDQPAESIIWQVGRGMKQSLANLQS--GRDVKDLLMLCWTYEKEHRPQFARLLSLLEHLPK 945
            |..|:.....::.:  |..|.:....:.|  ......|:..||..:...||.|..:|..|..:.:
Human   346 EVPFRGIDGLAVAY--GVAMNKLALPIPSTCPEPFAKLMEDCWNPDPHSRPSFTNILDQLTTIEE 408

  Fly   946 KRLARSP 952
            ......|
Human   409 SGFFEMP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 94/289 (33%)
Pkinase_Tyr 679..940 CDD:285015 93/282 (33%)
MAP3K9XP_011535090.1 SH3_MLK1-3 56..113 CDD:212992 10/62 (16%)
STKc_MLK1 137..406 CDD:271047 95/292 (33%)
TyrKc 144..403 CDD:197581 93/282 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.