DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and Tak1

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_524080.1 Gene:Tak1 / 39659 FlyBaseID:FBgn0026323 Length:678 Species:Drosophila melanogaster


Alignment Length:280 Identity:65/280 - (23%)
Similarity:132/280 - (47%) Gaps:29/280 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   674 IPYGDLLLLERIGQGRFGTVHRALWHGD-VAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLV 737
            :.:.::.|.|::|.|.:|.|.:|:|... ||||   |.:...|.  :....||......:|.|::
  Fly    14 VDFSEITLREKVGHGSYGVVCKAVWRDKLVAVK---EFFASAEQ--KDIEKEVKQLSRVKHPNII 73

  Fly   738 LFMGACMNPPYLAIVTSLCKGNTLYTYIHQR-REKFAMNRTLLIAQQIAQGMGYLHA---REIIH 798
            ...|.........::....:|.:|:.::|.: :..:::...:..|:|.|:|:.||||   :.:||
  Fly    74 ALHGISSYQQATYLIMEFAEGGSLHNFLHGKVKPAYSLAHAMSWARQCAEGLAYLHAMTPKPLIH 138

  Fly   799 KDLRTKNIFIEN-GKVI-ITDFGLFSSTKLLYCDMGLGVPHNWLCYLAPELIRALQPEKPRGECL 861
            :|::..|:.:.| |:.: |.|||..:....:..:     ......::|||:.          |..
  Fly   139 RDVKPLNLLLTNKGRNLKICDFGTVADKSTMMTN-----NRGSAAWMAPEVF----------EGS 188

  Fly   862 EFTPYSDVYSFGTVWYELICGEFTFKD-QPAESIIWQVGRGMKQSLANLQSGRDVKDLLMLCWTY 925
            ::|...|::|:..|.:|::..:..||. ..|.:|.|::.:|.:..|......| ::||:..||..
  Fly   189 KYTEKCDIFSWAIVLWEVLSRKQPFKGIDNAYTIQWKIYKGERPPLLTTCPKR-IEDLMTACWKT 252

  Fly   926 EKEHRPQFARLLSLLEHLPK 945
            ..|.||....::.::..:.|
  Fly   253 VPEDRPSMQYIVGVMHEIVK 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 65/276 (24%)
Pkinase_Tyr 679..940 CDD:285015 64/268 (24%)
Tak1NP_524080.1 TyrKc 19..264 CDD:197581 64/265 (24%)
STKc_TAK1 25..275 CDD:270960 63/269 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445260
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.