DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and ARAF

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_001243125.1 Gene:ARAF / 369 HGNCID:646 Length:609 Species:Homo sapiens


Alignment Length:604 Identity:174/604 - (28%)
Similarity:263/604 - (43%) Gaps:135/604 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 HRFTKALGF-MATCTLCQKQVFHRWMKCTDCKYICHKSCAPHVPPSC---GLPREYVDEFRHIKE 432
            |.|.:...| :|.|..|.|.:||.: :|..|.|..|:.|:..||..|   ...|:....|.|   
Human    99 HNFVRKTFFSLAFCDFCLKFLFHGF-RCQTCGYKFHQHCSSKVPTVCVDMSTNRQQPSRFYH--- 159

  Fly   433 QGGYASLPHVHGAAKGSPLVKKSTLGKPLHQQHGDSSSPSSSCTSSTPSSPALFQQRERELDQAG 497
                 |:..:.|.::                ||                             :|.
Human   160 -----SVQDLSGGSR----------------QH-----------------------------EAP 174

  Fly   498 SSSSANLLPTPSLGKHQPSQFNFPNVTVTSSGGSGGVSLISNEPVPEQFPTAPATANGGLDSLVS 562
            |:...|.|.||.                       |.|..:....||.|| .||.||..|..:.|
Human   175 SNRPLNELLTPQ-----------------------GPSPRTQHCDPEHFP-FPAPANAPLQRIRS 215

  Fly   563 SS--NGHMSSLIGSQTSNASTAATLTGSLVNSTTTTSTCSFFPRKLSTAGVDKRTPFTSEYTDTH 625
            :|  |.||          .||.|.:..:|:..|..:.:......:..:.|..:.:|..:..:...
Human   216 TSTPNVHM----------VSTTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGR 270

  Fly   626 KSNDSDKTVSLSGSASTDSDRTPVRVDSTEDGDSGQWRQNSISLKEWDIPYGDLLLLERIGQGRF 690
            ||..|..........|...|:.  :|.:....|||.:         |::|..::.||:|||.|.|
Human   271 KSPHSKSPAEQRERKSLADDKK--KVKNLGYRDSGYY---------WEVPPSEVQLLKRIGTGSF 324

  Fly   691 GTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGACMNPPYLAIVTSL 755
            |||.|..||||||||:|.......| ..:.|::|:...:.|||.|::|||| .|..|..||:|..
Human   325 GTVFRGRWHGDVAVKVLKVSQPTAE-QAQAFKNEMQVLRKTRHVNILLFMG-FMTRPGFAIITQW 387

  Fly   756 CKGNTLYTYIHQRREKFAMNRTLLIAQQIAQGMGYLHAREIIHKDLRTKNIFIENGKVI-ITDFG 819
            |:|::||.::|....:|.|.:.:.:|:|.||||.||||:.|||:||::.|||:..|..: |.|||
Human   388 CEGSSLYHHLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFG 452

  Fly   820 LFSSTKLLYCDMGLGVPHNWLCYLAPELIRALQPEKPRGECLEFTPY---SDVYSFGTVWYELIC 881
            |.:..........|..|...:.::|.|:||...|          .||   ||||::|.|.|||:.
Human   453 LATVKTRWSGAQPLEQPSGSVLWMAAEVIRMQDP----------NPYSFQSDVYAYGVVLYELMT 507

  Fly   882 GEFTF-----KDQPAESIIWQVGRG-MKQSLANLQSG--RDVKDLLMLCWTYEKEHRPQFARLLS 938
            |...:     :||    ||:.|||| :...|:.:.|.  :.::.||..|..:::|.||.|.::|:
Human   508 GSLPYSHIGCRDQ----IIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILA 568

  Fly   939 LLEHLPKK--RLARSPSHP 955
            .:|.|.:.  ::.||.|.|
Human   569 TIELLQRSLPKIERSASEP 587

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556 17/50 (34%)
PK_KSR 678..946 CDD:270965 106/279 (38%)
Pkinase_Tyr 679..940 CDD:285015 104/272 (38%)
ARAFNP_001243125.1 Raf_RBD 20..91 CDD:176411
C1_1 99..146 CDD:278556 17/47 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..210 19/115 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 243..293 7/51 (14%)
STKc_A-Raf 312..576 CDD:271052 106/279 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.