DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and Mos

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_610817.1 Gene:Mos / 36404 FlyBaseID:FBgn0033773 Length:364 Species:Drosophila melanogaster


Alignment Length:339 Identity:75/339 - (22%)
Similarity:122/339 - (35%) Gaps:108/339 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   677 GDLLL------------------LERIGQGRFGTVHRALWHG-DVAVKLLNEDYLQDEHMLETFR 722
            |||||                  .:.:|:|.:|||.:|::.. .||||::.      .....|..
  Fly     2 GDLLLNTPKRKQLLKDGPPVPTRCQVLGRGAYGTVFKAIYRDRSVAVKIIR------AQAASTLH 60

  Fly   723 SEVANFKNTRHENLVLFMGACMNPPYLAIVTSLCKGNTLYTYIHQRREKFA---MNRTLLIAQQI 784
            :| ::..|..|.|:|..:.......:..::....:|.:|...:    :..|   |:| :||...:
  Fly    61 NE-SHLLNLEHRNIVRLLKLESAADFGLVIMECPRGQSLQRIV----DTLALPLMHR-VLITLDV 119

  Fly   785 AQGMGYLHAREIIHKDLRTKNIFIENG-KVIITDFGLFSSTKLLY----CDMGLGVPHNWLC--- 841
            ...:.|.|::.::|.|::..||.:..| |..||........|..|    ||.|..:.....|   
  Fly   120 VAALRYCHSQNVLHLDVKPTNILVALGTKSSITCNSSKIKVKRSYICKLCDFGSSIEMGEFCAWQ 184

  Fly   842 --YLAPELIRALQPEKPRGECLEFTPYSDVYSFG-TVW---------YELICGE----------- 883
              .:|...:|.:.||..|.:.|  |..||:||.| |:|         :.|.|.|           
  Fly   185 EPSVAKGTLRYMSPEALRSDTL--TEASDIYSLGITMWQLQARRLPYHTLDCNETIAYQVVKHEL 247

  Fly   884 ---------FTFKDQPAESIIWQVGRGMKQSLANL-------------------QSGRDVKDLLM 920
                     ....|.|.: ..|.:..   :|.||:                   ..|||:|    
  Fly   248 RPDNYHQLKILALDSPID-CDWDLAH---ESTANVICRRANTSARRNLSLDPSYTVGRDLK---- 304

  Fly   921 LCWTYEKEHRPQFA 934
                 :|.||.:.|
  Fly   305 -----KKRHRNRLA 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 74/338 (22%)
Pkinase_Tyr 679..940 CDD:285015 73/337 (22%)
MosNP_610817.1 STKc_Mos 19..298 CDD:270881 62/296 (21%)
S_TKc 26..257 CDD:214567 56/244 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445259
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23257
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.