DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and LIMK1

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_511139.2 Gene:LIMK1 / 32207 FlyBaseID:FBgn0283712 Length:1257 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:100/241 - (41%) Gaps:52/241 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   678 DLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGA 742
            ||::.|::|:|.||.|.:........|.:|.|.:..||.....|..|||..:...|.:::.|:|.
  Fly   400 DLVIGEKLGEGFFGKVFKVTHRQSGEVMVLKELHRADEEAQRNFIKEVAVLRLLDHRHVLKFIGV 464

  Fly   743 CMNPPYLAIVTSLCKGNTLYTYIHQRREKFAMNRTLLIAQQIAQGMGYLHAREIIHKDLRTKNIF 807
            ......|.:||....|..|...||...:.....:.:.:|:.||.||.|||:..|||:||.:.|..
  Fly   465 LYKDKKLHMVTEYVAGGCLKELIHDPAQVLPWPQRVRLARDIACGMSYLHSMNIIHRDLNSMNCL 529

  Fly   808 I-ENGKVIITDFGLFSSTKLLYCDMG-------------------------------------LG 834
            : |:..||:.||||..|........|                                     :|
  Fly   530 VREDRSVIVADFGLARSVDAPRLPSGNMTPGGYGSGANSDAPMSPSGTLRRSKSRQRRQRYTVVG 594

  Fly   835 VPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELI 880
            .|:    ::|||:::.          |::....||:|||.:..|:|
  Fly   595 NPY----WMAPEMMKG----------LKYDEKVDVFSFGIMLCEII 626

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 63/241 (26%)
Pkinase_Tyr 679..940 CDD:285015 62/240 (26%)
LIMK1NP_511139.2 LIM1_LIMK 33..88 CDD:188750
LIM2_LIMK 95..148 CDD:188751
PDZ_signaling 172..271 CDD:238492
STKc_LIMK 407..693 CDD:271056 60/234 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445218
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.