Sequence 1: | NP_001287177.1 | Gene: | ksr / 40660 | FlyBaseID: | FBgn0015402 | Length: | 966 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_511139.2 | Gene: | LIMK1 / 32207 | FlyBaseID: | FBgn0283712 | Length: | 1257 | Species: | Drosophila melanogaster |
Alignment Length: | 241 | Identity: | 63/241 - (26%) |
---|---|---|---|
Similarity: | 100/241 - (41%) | Gaps: | 52/241 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 678 DLLLLERIGQGRFGTVHRALWHGDVAVKLLNEDYLQDEHMLETFRSEVANFKNTRHENLVLFMGA 742
Fly 743 CMNPPYLAIVTSLCKGNTLYTYIHQRREKFAMNRTLLIAQQIAQGMGYLHAREIIHKDLRTKNIF 807
Fly 808 I-ENGKVIITDFGLFSSTKLLYCDMG-------------------------------------LG 834
Fly 835 VPHNWLCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELI 880 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
ksr | NP_001287177.1 | KSR1-SAM | 33..166 | CDD:290277 | |
C1_1 | 368..419 | CDD:278556 | |||
PK_KSR | 678..946 | CDD:270965 | 63/241 (26%) | ||
Pkinase_Tyr | 679..940 | CDD:285015 | 62/240 (26%) | ||
LIMK1 | NP_511139.2 | LIM1_LIMK | 33..88 | CDD:188750 | |
LIM2_LIMK | 95..148 | CDD:188751 | |||
PDZ_signaling | 172..271 | CDD:238492 | |||
STKc_LIMK | 407..693 | CDD:271056 | 60/234 (26%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45445218 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |