DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksr and Ripk1

DIOPT Version :9

Sequence 1:NP_001287177.1 Gene:ksr / 40660 FlyBaseID:FBgn0015402 Length:966 Species:Drosophila melanogaster
Sequence 2:NP_001100820.1 Gene:Ripk1 / 306886 RGDID:1310158 Length:658 Species:Rattus norvegicus


Alignment Length:321 Identity:77/321 - (23%)
Similarity:125/321 - (38%) Gaps:95/321 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   664 QNSISLKEWDIPYGDLLLLERIGQGRFGTV----HRALWHGDVAVKLL---------NEDYLQDE 715
            |..:||....:...|||..:.:..|.||.|    ||.  ||.|.:|.:         ||..|::.
  Rat     2 QPDMSLDNIKMASDDLLERKDLDSGGFGKVSLCFHRT--HGFVILKKVYTGPNRAEYNEALLEEG 64

  Fly   716 HMLETFRSEVANFKNTRHENLVLFMGACMNP-PYLAIVTSLCKGNTLYTYIHQRREKFAMNRTLL 779
            .|:.          ..||:.:|..:|..:.. .|..::..:.:||.:  ::.:.:|...::....
  Rat    65 KMMH----------RLRHDRVVKLLGIIIEEGNYSLVMEYMEQGNLM--HVLKTKESVPLSVKGR 117

  Fly   780 IAQQIAQGMGYLHAREIIHKDLRTKNIFIENGKVIITDFGLFSSTKLLYCDMGLGVPHNW----- 839
            |..:|.:||.|||...:|||||:.:||.::.      ||      .:...|:|:.....|     
  Rat   118 IIVEIIEGMHYLHDEGVIHKDLKPENILVDR------DF------HIKIADLGVASFKTWSKLTK 170

  Fly   840 -------------------LCYLAPELIRALQPEKPRGECLEFTPYSDVYSFGTVWYELICGEFT 885
                               |.|:|||.:..:. .||       |..||||||..|.:.:...:  
  Rat   171 EEHNKQREASSVTKKNGGTLYYMAPEHLTDIN-TKP-------TEKSDVYSFAIVLWAIFANK-- 225

  Fly   886 FKDQPAESIIWQVGRGMKQSLANLQSG-------------RDVKDLLMLCWTYEKEHRPQF 933
               :|.|::|.     .:|.|..:.||             |::..|:..||....|.||.|
  Rat   226 ---EPYENVIC-----TEQFLVCINSGNRPNVEDILEFCPREIISLMERCWQTNPEDRPTF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ksrNP_001287177.1 KSR1-SAM 33..166 CDD:290277
C1_1 368..419 CDD:278556
PK_KSR 678..946 CDD:270965 74/307 (24%)
Pkinase_Tyr 679..940 CDD:285015 73/306 (24%)
Ripk1NP_001100820.1 PKc_like 23..290 CDD:419665 71/300 (24%)
Death_RIP1 570..655 CDD:260048
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.