Sequence 1: | NP_005574.2 | Gene: | LYL1 / 4066 | HGNCID: | 6734 | Length: | 280 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001259243.1 | Gene: | HLH4C / 31397 | FlyBaseID: | FBgn0011277 | Length: | 191 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 58/201 - (28%) |
---|---|---|---|
Similarity: | 71/201 - (35%) | Gaps: | 87/201 - (43%) |
- Green bases have known domain annotations that are detailed below.
Human 17 KAEMVC--APSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGVPVISLGHSRPPGVAMPTTE 79
Human 80 LGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGPFSIFPSSRLKRRPSHCELDLAEGH 144
Human 145 QPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLSKNEVLRLAMKYIGFLVRLLR-- 207
Human 208 -DQAAA 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
LYL1 | NP_005574.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..60 | 14/44 (32%) | |
HLH | 156..208 | CDD:197674 | 30/54 (56%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 214..280 | ||||
HLH4C | NP_001259243.1 | HLH | 108..165 | CDD:238036 | 30/67 (45%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4029 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 86 | 1.000 | Inparanoid score | I5161 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.860 |