DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment LYL1 and Fer1

DIOPT Version :9

Sequence 1:NP_005574.2 Gene:LYL1 / 4066 HGNCID:6734 Length:280 Species:Homo sapiens
Sequence 2:NP_001262334.1 Gene:Fer1 / 2768661 FlyBaseID:FBgn0037475 Length:256 Species:Drosophila melanogaster


Alignment Length:165 Identity:45/165 - (27%)
Similarity:64/165 - (38%) Gaps:54/165 - (32%)


- Green bases have known domain annotations that are detailed below.


Human   125 PSSRLKRRPSH--CELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTHPPDRKLS 187
            |.||...:|..  |...:|:        :|...|.|||.|.|::|.||..||..:||.|.:::||
  Fly    67 PFSRRSHKPRRLKCASQMAQ--------QRQAANLRERRRMQSINEAFEGLRTHIPTLPYEKRLS 123

Human   188 KNEVLRLAMKYIGFLVR---------------------------LLRDQAAALA-------AGPT 218
            |.:.|:||:.||.||..                           :|:|:...:|       .|..
  Fly   124 KVDTLKLAISYITFLSEMVKKDKNGNEPGLSLQRNYQKEPPKKIILKDRTGGVAHSLSWYRKGDR 188

Human   219 PPGPRKRPVHRVPDDGARRGSGRRAEAAARSQPAP 253
            .||.:.......|:|  .||        ..|||.|
  Fly   189 YPGSKLYARTWTPED--PRG--------PHSQPLP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LYL1NP_005574.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..60
HLH 156..208 CDD:197674 25/78 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..280 12/47 (26%)
Fer1NP_001262334.1 HLH 92..144 CDD:197674 24/51 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4029
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.