DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snr1 and SNF5

DIOPT Version :9

Sequence 1:NP_730935.1 Gene:Snr1 / 40657 FlyBaseID:FBgn0011715 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_009848.4 Gene:SNF5 / 852592 SGDID:S000000493 Length:905 Species:Saccharomyces cerevisiae


Alignment Length:261 Identity:90/261 - (34%)
Similarity:137/261 - (52%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 VPQATPINRNRVHTKKVRTFPMCFDDTDPTASLENAAQKECLVPIRLDMELEGQK--LRDTFTWN 191
            :||....||......|::.:....::|           .|.||||||:.:.:..:  ||||..||
Yeast   427 IPQVEVGNRKHYLEDKLKVYKQAMNET-----------SEQLVPIRLEFDQDRDRFFLRDTLLWN 480

  Fly   192 KNESMITPEQFAEVLCDDL---DLNPLPFVPAIAQAIRQQIEAFPNDPPI-LEET----CDQRVI 248
            ||:.:|..|.|.:.:..|.   |......:..|.|:|::||:.|..:|.| |.:.    .|.|:.
Yeast   481 KNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIR 545

  Fly   249 VKLNIHVGNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGLGGEFVTAIAYSIRGQLSWHCRT--- 310
            :||:|.||...|:||.|||:|..:|.|||||..:|.||.|.||||||||:|||.|:..:.::   
Yeast   546 IKLDIVVGQNQLIDQFEWDISNSDNCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLAL 610

  Fly   311 --YAFSEA------------PLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTRRMR 361
              |.|..:            |..|:|..:|..:::..:.|.|..::.||:|:..:|:||:|||.|
Yeast   611 LGYNFDGSAIEDDDIRSRMLPTITLDDVYRPAAESKIFTPNLLQISAAELERLDKDKDRDTRRKR 675

  Fly   362 R 362
            |
Yeast   676 R 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snr1NP_730935.1 WH_NTD_SMARCB1 5..92 CDD:411036
SNF5 165..348 CDD:398495 75/209 (36%)
SNF5NP_009848.4 SNF5 452..662 CDD:398495 76/220 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345007
Domainoid 1 1.000 90 1.000 Domainoid score I1779
eggNOG 1 0.900 - - E1_KOG1649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1514
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002902
OrthoInspector 1 1.000 - - oto99405
orthoMCL 1 0.900 - - OOG6_103095
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1364
SonicParanoid 1 1.000 - - X1914
TreeFam 1 0.960 - -
1110.580

Return to query results.
Submit another query.