DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snr1 and BSH

DIOPT Version :9

Sequence 1:NP_730935.1 Gene:Snr1 / 40657 FlyBaseID:FBgn0011715 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_001189918.1 Gene:BSH / 821025 AraportID:AT3G17590 Length:242 Species:Arabidopsis thaliana


Alignment Length:251 Identity:75/251 - (29%)
Similarity:115/251 - (45%) Gaps:61/251 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PMCFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWN----KNESMITPEQFAEVLCDD 209
            |:.|....|||        |.|||||||::.|||:.:|.||||    .||.:|    ||:....|
plant    12 PVKFRIYRPTA--------ENLVPIRLDIQFEGQRYKDAFTWNPSDPDNEVVI----FAKRTVKD 64

  Fly   210 LDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETCDQRVIVKLNIHVGNTSLVDQVEWDMSEKNNN 274
            |.| |..||..|||:|:.|:..|.........|.::.:.:||::.|.:|.:.||..||::...::
plant    65 LKL-PYAFVTQIAQSIQSQLSDFRAYEGQDMYTGEKIIPIKLDLRVNHTLIKDQFLWDLNNFESD 128

  Fly   275 PEEFAIKLCAELGL-GGEFVTAIAYSIRGQL-----------------------SWH-------- 307
            |||||..||.:||: ..|...|:|::||.||                       |.|        
plant   129 PEEFARTLCKDLGVEDPEVGPAVAFAIREQLYEIAIQSVASARESRLSKKGRRGSDHGSASKASG 193

  Fly   308 -----CRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTR 358
                 .:.::|..:.:       |...|.|.:.|.::.||..|::.....::|:.|
plant   194 LSMDLMKLFSFKSSVV-------RKRKDLDVYEPVVDLLTSEEVDALEAREERHAR 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snr1NP_730935.1 WH_NTD_SMARCB1 5..92 CDD:411036
SNF5 165..348 CDD:398495 68/223 (30%)
BSHNP_001189918.1 SNF5 23..159 CDD:398495 56/140 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4188
eggNOG 1 0.900 - - E1_KOG1649
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002902
OrthoInspector 1 1.000 - - oto3286
orthoMCL 1 0.900 - - OOG6_103095
Panther 1 1.100 - - LDO PTHR10019
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1914
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.