DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Snr1 and sfh1

DIOPT Version :9

Sequence 1:NP_730935.1 Gene:Snr1 / 40657 FlyBaseID:FBgn0011715 Length:370 Species:Drosophila melanogaster
Sequence 2:NP_588001.1 Gene:sfh1 / 2539144 PomBaseID:SPCC16A11.14 Length:418 Species:Schizosaccharomyces pombe


Alignment Length:220 Identity:76/220 - (34%)
Similarity:116/220 - (52%) Gaps:17/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 AAQKECLVPIRLDMEL-EGQKLRDTFTWNKNESMITPEQFAEVLCDDLDLNPLPFVPAIAQAIRQ 227
            |.:::..:|||||:|| ...:|:|||.||.||.::||:.||::||.||||:...:...|:.:||.
pombe   111 AEERDVYIPIRLDIELPNNYRLKDTFLWNMNEQVMTPDVFAQILCADLDLSTNVYGTQISSSIRA 175

  Fly   228 QIEAFPNDPPILEETC--DQRVIVKLNIHV--GNTSLVDQVEWDMSEKNNNPEEFAIKLCAELGL 288
            |||.:   .|:.|...  .|.::|..||.|  ...|..|||||:::.. ..||||::..|.:|||
pombe   176 QIEEY---APVAEVPMPKGQEMLVVFNIQVQLAQLSYNDQVEWNLTSP-LTPEEFSVLTCNDLGL 236

  Fly   289 GGEFVTAIAYSIRGQLSWHCRTYAFSEAPLSTID-VPFRNP---SDADA----WAPFLETLTDAE 345
            .||....|||:|...|....:.....:.|....| ||....   .|.|.    |.|.|||::..:
pombe   237 SGESRPEIAYAIHECLLKLKKNACEGDLPDYDSDAVPGTKAGPRQDMDTLGALWQPVLETVSLED 301

  Fly   346 MEKKIRDQDRNTRRMRRLANTTTGW 370
            .:|...:::...::.||.|:...|:
pombe   302 AKKNENNRENLVKQWRREASKFGGF 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Snr1NP_730935.1 WH_NTD_SMARCB1 5..92 CDD:411036
SNF5 165..348 CDD:398495 70/195 (36%)
sfh1NP_588001.1 SNF5 118..261 CDD:282681 59/146 (40%)
GATA 372..409 CDD:278735
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2708
eggNOG 1 0.900 - - E1_KOG1649
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 106 1.000 Inparanoid score I1612
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002902
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR10019
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1364
SonicParanoid 1 1.000 - - X1914
TreeFam 00.000 Not matched by this tool.
98.990

Return to query results.
Submit another query.