DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and Dcr-2

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_523778.2 Gene:Dcr-2 / 36993 FlyBaseID:FBgn0034246 Length:1722 Species:Drosophila melanogaster


Alignment Length:242 Identity:53/242 - (21%)
Similarity:97/242 - (40%) Gaps:68/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LGESFELSELQRAFTEKSFAEREEDRRR---QLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQ 135
            |.|:.:|||:...|.  :|.|.:..|..   ::.:||:|:| |...||.::.......:....:.
  Fly  1526 LAENAKLSEIISKFV--NFQESQGHRVTNYVRILLEEADVQ-PTPLDLDDELDMTELPHANKCIS 1587

  Fly   136 HQLPK-VPNEGLQAIASYLLSTETLAHVSTHLGTKDLIQSTEYPPSAESQAKSLHAVIGALASSS 199
            .:..| ||.:|     .:.:||                 :.:.|       |:|..|:.||    
  Fly  1588 QEAEKGVPPKG-----EFNMST-----------------NVDVP-------KALGDVLEAL---- 1619

  Fly   200 GIERAFIFVRDF-----ICTQLNQKDLLEVWTPQEPIQLLEKICQER--KLGEAEPRLLGDCGKN 257
             |...::..||.     :...|.:.:|.| :|.:.||..:.::.:.:  |...:.|.:.|:    
  Fly  1620 -IAAVYLDCRDLQRTWEVIFNLFEPELQE-FTRKVPINHIRQLVEHKHAKPVFSSPIVEGE---- 1678

  Fly   258 TVLAAYQ-------VGIYANRQLLGKGFGEDVKTATETAALDALQSI 297
            ||:.:.|       :.:|        |||.:...|..:||..|||.:
  Fly  1679 TVMVSCQFTCMEKTIKVY--------GFGSNKDQAKLSAAKHALQQL 1717

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 52/239 (22%)
RIBOc 81..219 CDD:197778 29/146 (20%)
Dcr-2NP_523778.2 MPH1 6..542 CDD:224036
DEXDc 22..173 CDD:238005
Dicer_PBD 241..343 CDD:277191
HELICc <438..495 CDD:197757
Dicer_dimer 572..665 CDD:281376
PAZ 843..1004 CDD:198017
RIBOc 1194..1391 CDD:238333
Rnc 1433..1719 CDD:223644 53/242 (22%)
RIBOc 1448..1649 CDD:238333 34/160 (21%)
dsrm 1653..1717 CDD:278464 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.