DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and Drosha

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001101125.2 Gene:Drosha / 310159 RGDID:1307626 Length:1373 Species:Rattus norvegicus


Alignment Length:275 Identity:66/275 - (24%)
Similarity:109/275 - (39%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PTLRE--LAHRQKKLGPQKPERRSGFVEWNQ-RSELFAFGKRLGESF-ELSELQRAFTEKSFAER 95
            |.|||  |.:....|..|:|......:|.:. ..:|..|.:.:|..| .:..|.||||       
  Rat  1071 PDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFT------- 1128

  Fly    96 EEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLA 160
                .|.:|.  :.|.:.||..:...|..|.:.....:|....|......|..:.|.|::..|.|
  Rat  1129 ----LRTVGF--NHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQA 1187

  Fly   161 HVSTHLGTKDLI---QSTEYPPSAESQ--AKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKD 220
            .|:..||.::..   ..|:.|.:..::  |..|.:.|.||.....:|....|:......:|.:..
  Rat  1188 KVAEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFI 1252

  Fly   221 LLEVWTPQEPIQLLEKICQERKLGEAEP-----RLLGDCGKNTVLAAYQVGIYANRQLLGKGFGE 280
            |.:.|  .:|...|::.|...:....||     :.|...|.:.. ..|.|.:|...:.:|.|.|.
  Rat  1253 LNQDW--NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHA-RTYTVAVYFKGERIGCGKGP 1314

  Fly   281 DVKTATETAALDALQ 295
            .::.|...||:|||:
  Rat  1315 SIQQAEMGAAMDALE 1329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 55/235 (23%)
RIBOc 81..219 CDD:197778 32/142 (23%)
DroshaNP_001101125.2 SF-CC1 212..>274 CDD:273721
RIBOc 958..1078 CDD:238333 4/6 (67%)
rnc 1104..1332 CDD:234633 57/242 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.