DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and Dicer1

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_008763126.1 Gene:Dicer1 / 299284 RGDID:1309381 Length:1918 Species:Rattus norvegicus


Alignment Length:246 Identity:50/246 - (20%)
Similarity:89/246 - (36%) Gaps:69/246 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 KRWVSPTLRELAHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESFELSELQRAFTEKSFAE 94
            :|:.:..|..|.   |:.|.|.||  ..::..|     |..|..:|::...|:...|...|    
  Rat   450 RRYTAVVLNRLI---KEAGKQDPE--LAYISSN-----FITGHGIGKNQPRSKQMEAEFRK---- 500

  Fly    95 REEDRRRQLGIEESDLQMPHNSDLVEKGQQIA--------------RAYVEAFLQHQLPKVPNEG 145
             :|:..|:....|::|.:.  :.:||:|..|.              |:||::..:.:.|      
  Rat   501 -QEEVLRKFRAHETNLLIA--TSVVEEGVDIPKCNLVVRFDLPTEYRSYVQSKGRARAP------ 556

  Fly   146 LQAIASY--LLSTETLAHVSTHLGTKDLIQS---TEYPPSAESQAKSLHAVIG--------ALAS 197
               |::|  |..|:.:......|.|...|:.   .:...|.:.....:|||:.        .|..
  Rat   557 ---ISNYVMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDGAEADVHAVVDDDDVFPPYVLRP 618

  Fly   198 SSG-----IERAFIFVRDFICTQLNQKDLLEVWTPQEPIQLLEKICQERKL 243
            ..|     |..|...:..: |.:|          |.:|...|...|:.|:|
  Rat   619 DDGGPRVTINTAIGHINRY-CARL----------PSDPFTHLAPKCRTREL 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 39/204 (19%)
RIBOc 81..219 CDD:197778 32/169 (19%)
Dicer1XP_008763126.1 DEXHc_dicer 42..239 CDD:350792
Dicer_PBD 271..365 CDD:277191
SF2_C_dicer 372..564 CDD:350189 29/139 (21%)
Dicer_dimer 630..718 CDD:397444 9/40 (23%)
PAZ_dicer_like 886..1008 CDD:239209
RIBOc 1296..>1387 CDD:197778
RIBOc 1678..1842 CDD:238333
DSRM_DICER 1847..1909 CDD:380680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.