DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and DROSHA

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001369437.1 Gene:DROSHA / 29102 HGNCID:17904 Length:1374 Species:Homo sapiens


Alignment Length:275 Identity:66/275 - (24%)
Similarity:109/275 - (39%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PTLRE--LAHRQKKLGPQKPERRSGFVEWNQ-RSELFAFGKRLGESF-ELSELQRAFTEKSFAER 95
            |.|||  |.:....|..|:|......:|.:. ..:|..|.:.:|..| .:..|.||||       
Human  1072 PDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTHVRLLARAFT------- 1129

  Fly    96 EEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLA 160
                .|.:|.  :.|.:.||..:...|..|.:.....:|....|......|..:.|.|::..|.|
Human  1130 ----LRTVGF--NHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQA 1188

  Fly   161 HVSTHLGTKDLI---QSTEYPPSAESQ--AKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKD 220
            .|:..||.::..   ..|:.|.:..::  |..|.:.|.||.....:|....|:......:|.:..
Human  1189 KVAEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFI 1253

  Fly   221 LLEVWTPQEPIQLLEKICQERKLGEAEP-----RLLGDCGKNTVLAAYQVGIYANRQLLGKGFGE 280
            |.:.|  .:|...|::.|...:....||     :.|...|.:.. ..|.|.:|...:.:|.|.|.
Human  1254 LNQDW--NDPKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHA-RTYTVAVYFKGERIGCGKGP 1315

  Fly   281 DVKTATETAALDALQ 295
            .::.|...||:|||:
Human  1316 SIQQAEMGAAMDALE 1330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 55/235 (23%)
RIBOc 81..219 CDD:197778 32/142 (23%)
DROSHANP_001369437.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..95
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 130..406
U2AF_lg 217..>317 CDD:273727
Necessary for interaction with DGCR8 and pri-miRNA processing activity. /evidence=ECO:0000269|PubMed:26027739, ECO:0000269|PubMed:26748718 390..1365 66/275 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 452..497
RIBOc 959..1079 CDD:238333 4/6 (67%)
rnc 1105..1333 CDD:234633 57/242 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.