DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and mrpl3

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_596672.1 Gene:mrpl3 / 2541040 PomBaseID:SPBC3B9.14c Length:326 Species:Schizosaccharomyces pombe


Alignment Length:261 Identity:51/261 - (19%)
Similarity:114/261 - (43%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SELFAFGKRLG--ESFELSELQRAFTEKSFAEREEDRRRQLGIEESDLQMPH--NSDLVEKGQQI 125
            |:::...||:|  ||:.:..|.:|..:|:.                 :|.|.  |..|...|:..
pombe    45 SKVYTLKKRIGLPESYPMKVLVQALIDKTV-----------------VQNPQYSNEKLWSIGKVF 92

  Fly   126 ARAYVEAFLQHQLPKVPNEGLQAIASYLLSTETLAHVSTHLGTK--------------------- 169
            ...||..:::.:.|::|.|.:..:.:..:.::.|:.::|..|.:                     
pombe    93 GDFYVLEYIKCKYPRLPEEAVHGMQNGWMGSKALSQLATIWGLEVQRREEGLQESFGKVLAKRAD 157

  Fly   170 -DLIQSTEYPPSAESQAKSLHAVIGALASSSGIERAFIFVRDFICT-QLNQKDLLEVWTPQEPIQ 232
             ::::........|:..:::.|::|.:....|......|:.|.|.: ||:.:.:|::   |.|.:
pombe   158 PEMLRKPGEIYKDEAARRAILAILGGVYLHQGFNDTKKFINDHILSKQLDPRTMLQL---QWPRR 219

  Fly   233 LLEKICQERKLGEAEPRLLGDCGKNTVLAAYQVGIYANRQLLGKGFGEDVKTATETAALDALQSI 297
            .|.::|:...|.|...|::.:.|:.:....:.:|.|:...|||:|....:..|.:.||.::|.|.
pombe   220 QLSRLCKRLSLKEPVYRIIAETGRKSREPVFVIGAYSGHHLLGQGQASSLNLAEQQAAYNSLISY 284

  Fly   298 F 298
            :
pombe   285 Y 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 49/250 (20%)
RIBOc 81..219 CDD:197778 25/162 (15%)
mrpl3NP_596672.1 Rnc 40..290 CDD:223644 51/261 (20%)
RIBOc 65..209 CDD:197778 25/160 (16%)
DSRM 217..285 CDD:214634 18/67 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0571
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I2017
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005847
OrthoInspector 1 1.000 - - oto101471
orthoMCL 1 0.900 - - OOG6_105063
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2919
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.