DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL44 and drsh-1

DIOPT Version :9

Sequence 1:NP_649541.1 Gene:mRpL44 / 40656 FlyBaseID:FBgn0037330 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_492599.1 Gene:drsh-1 / 172830 WormBaseID:WBGene00009163 Length:1086 Species:Caenorhabditis elegans


Alignment Length:280 Identity:70/280 - (25%)
Similarity:109/280 - (38%) Gaps:37/280 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PTLREL-----AHRQKKLGPQKPERRSGFVEWNQRSELFAFGKRLGESF-ELSELQRAFTEKSFA 93
            |.|:|.     .|..|:..|| .:|...|:. ...|...|..:|||..| .:..|.:|||.::  
 Worm   798 PVLKEKWDHINEHELKREDPQ-GDRDLSFIT-PTLSTFHALEERLGIQFNNIRLLAKAFTRRN-- 858

  Fly    94 EREEDRRRQLGIEESDLQMPHNSDLVEKGQQIARAYVEAFLQHQLPKVPNEGLQAIASYLLSTET 158
                       |..:||...||..|...|..:.:..|..||..:.|......:..:.:.|:|.:|
 Worm   859 -----------IPNNDLTKGHNQRLEWLGDSVLQLIVSDFLYRRFPYHHEGHMSLLRTSLVSNQT 912

  Fly   159 LAHVSTHLGTKDLIQSTEYPP---SAESQAKSLHAVIGALASSSGIERAFIFVRDFICTQLNQKD 220
            .|.|...||..:.:....|..   ..:.:|..:.|.||||....|||....|:|...|.:|....
 Worm   913 QAVVCDDLGFTEFVIKAPYKTPELKLKDKADLVEAFIGALYVDRGIEHCRAFIRIVFCPRLKHFI 977

  Fly   221 LLEVWTPQEPIQLLEKIC-QERKLGEAEP-----RLLGDCG--KNTVLAAYQVGIYANRQLLGKG 277
            ..|.|...:  ..|::.| ..|....:||     |:||..|  .|.:   :::.:|...:.|...
 Worm   978 ESEKWNDAK--SHLQQWCLAMRDPSSSEPDMPEYRVLGIEGPTNNRI---FKIAVYYKGKRLASA 1037

  Fly   278 FGEDVKTATETAALDALQSI 297
            ...:|..|....|..||.::
 Worm  1038 AESNVHKAELRVAELALANL 1057

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL44NP_649541.1 Rnc 72..296 CDD:223644 59/235 (25%)
RIBOc 81..219 CDD:197778 36/140 (26%)
drsh-1NP_492599.1 RIBOc 672..793 CDD:197778
rnc 833..1058 CDD:234633 60/243 (25%)
RIBOc 848..976 CDD:197778 36/140 (26%)
DSRM 985..1058 CDD:214634 17/78 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.