DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLDIP2 and apaG

DIOPT Version :9

Sequence 1:NP_730934.1 Gene:POLDIP2 / 40655 FlyBaseID:FBgn0037329 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_414592.1 Gene:apaG / 944772 ECOCYCID:EG10047 Length:125 Species:Escherichia coli


Alignment Length:113 Identity:39/113 - (34%)
Similarity:61/113 - (53%) Gaps:1/113 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   293 VRITVIPFYMGCRETPASSVYWWRYCIRLENLGELSVQLRERHWRIFSLSGTLETVRGRGVVGQE 357
            |.|.|...|:..:.:|.:..|.:.|.:.:.|||...|||..|:|.|.:.:|....|:|.||||.:
E. coli     7 VCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRETEVQGEGVVGVQ 71

  Fly   358 PILSPRLPAFQYSSHVSLQAPSGHMWGTFRLEREDGYSFDCKIPPFSL 405
            |:::|. ..:||:|...::.|.|.|.|.:.:..|:|..|...||.|.|
E. coli    72 PLIAPG-EEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POLDIP2NP_730934.1 YccV-like 72..258 CDD:294919
DUF525 308..390 CDD:282262 28/81 (35%)
apaGNP_414592.1 apaG 1..125 CDD:180098 39/113 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 56 1.000 Domainoid score I624
eggNOG 1 0.900 - - E1_COG2967
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto111948
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14289
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.