DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLDIP2 and SKIP16

DIOPT Version :9

Sequence 1:NP_730934.1 Gene:POLDIP2 / 40655 FlyBaseID:FBgn0037329 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_563759.1 Gene:SKIP16 / 837120 AraportID:AT1G06110 Length:436 Species:Arabidopsis thaliana


Alignment Length:287 Identity:69/287 - (24%)
Similarity:103/287 - (35%) Gaps:88/287 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 NLGTTSQVDPKEVKGKVQTFYQVLIDTRDCPYIRAQTEAVTFLGNQDSNRSLY-AIPGLDYVAHE 231
            :||.:|::|...:...|....::.:  .||      |....|.|.  |||.|. .:|        
plant   191 DLGFSSRLDLIVMAASVVASLKIFL--LDC------TTGQLFTGT--SNRQLLPCVP-------- 237

  Fly   232 DIMPYSSSEKSPLQHELFDKFLTHAPDADPPFVGQDTLKAWQEKNHPWLDMSDVHKETTENVR-I 295
            |.:..|                .|..:.|..   ||.:..|.|::...|....::.....||: |
plant   238 DALVRS----------------VHDTNGDQQ---QDAMLLWLEEHGRRLQTGTINVRQQNNVKSI 283

  Fly   296 TVIPFYMGCRETP--------------ASSV--------------YWWRYCIRLENLGE------ 326
            ::.|      |.|              ||||              ||:.|.||:..:.|      
plant   284 SLFP------EIPPLCSVSVTNGVQVRASSVFIPEISNLRDQPPAYWYAYSIRMSLMPEGCILNG 342

  Fly   327 ---LSVQLRERHWRIFSLSGTLETVRGRGVVGQEPILSPRLPAFQYSSHVSLQAPSGHMWGTF-- 386
               .|.||..|||.|.:.:..::.|.|..|:|:.|:|......|.|.|..|....:|.:.|:|  
plant   343 THHSSCQLYWRHWVIRADNEVIDNVNGEAVIGKYPLLQAGEEEFVYESCSSFPTTAGSIDGSFTF 407

  Fly   387 ---RLEREDGYSFDCKIPPFSLESKPD 410
               .|....|..|:.|:..|.|| .||
plant   408 VPGSLRDPKGSQFEVKVVEFPLE-LPD 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POLDIP2NP_730934.1 YccV-like 72..258 CDD:294919 18/90 (20%)
DUF525 308..390 CDD:282262 32/123 (26%)
SKIP16NP_563759.1 SMI1_KNR4 85..>157 CDD:413042
DUF525 311..409 CDD:398192 26/97 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 43 1.000 Domainoid score I4761
eggNOG 1 0.900 - - E1_COG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.