DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment POLDIP2 and fbxo3

DIOPT Version :9

Sequence 1:NP_730934.1 Gene:POLDIP2 / 40655 FlyBaseID:FBgn0037329 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001333131.1 Gene:fbxo3 / 553731 ZFINID:ZDB-GENE-050522-269 Length:451 Species:Danio rerio


Alignment Length:257 Identity:59/257 - (22%)
Similarity:100/257 - (38%) Gaps:67/257 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 TNLGTTSQVDPKEVKGKVQTFYQVLIDTRDCPYIRAQTEAVTFLGNQDSNRSLYAIPGLDYVAHE 231
            |.|.....::..|.:.:.:.|||       ||...|          ||.:.....|.|.::.   
Zfish   198 TGLSQYMALETTEGRTRSEIFYQ-------CPDQLA----------QDPSAIDMFITGSNFT--- 242

  Fly   232 DIMPYSSSEKSPLQHELFDKFLTHAPDADPPFVGQDTLKAWQEKNHPWLDMSDVHKE----TTEN 292
                           |.|..::.:....:.|.:.....:.             ||.:    ||.:
Zfish   243 ---------------EWFTSYVDNVVTGEYPIIRDQIFRY-------------VHDKRCVATTGD 279

  Fly   293 VRITVIPFYMGCRETPASSV----YWWRYCIRLE----NLGELSVQLRERHWRIFSLSGTLETVR 349
            :.::|...::    ...|||    :::.|.||:|    .|.|.:.||..|:|:|.:.:|.:|.||
Zfish   280 ITVSVSTSFL----PELSSVHPPHFFFTYRIRIEMAKSALPEKACQLDSRYWKITNANGNVEEVR 340

  Fly   350 GRGVVGQEPILSPRLPAFQYSSHVSLQAPSGHMWG--TFRLEREDGYSFDCKIPPFSLESKP 409
            |.||||:.|:::|. ...:|:|..:....|.:|.|  ||...:.....||..||.|.:...|
Zfish   341 GPGVVGEFPVMTPG-KVHEYASCTTFSTTSEYMEGHYTFHRLKNKEEVFDVSIPRFHMVCPP 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
POLDIP2NP_730934.1 YccV-like 72..258 CDD:294919 15/90 (17%)
DUF525 308..390 CDD:282262 32/91 (35%)
fbxo3NP_001333131.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2967
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.