DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEK and Myt1

DIOPT Version :9

Sequence 1:NP_649538.1 Gene:PEK / 40653 FlyBaseID:FBgn0037327 Length:1162 Species:Drosophila melanogaster
Sequence 2:NP_647987.2 Gene:Myt1 / 38649 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster


Alignment Length:395 Identity:92/395 - (23%)
Similarity:151/395 - (38%) Gaps:95/395 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   820 DDYEEDEEQQGDHEKRHRSSVSIDIHSASFDLKNINYSQH--QLVSNSFQI-ESVRPKSSGSDDA 881
            ||....::..|::..|.|..........:.|..|:|.||.  ...:||.|| .::..:.:|..|:
  Fly    14 DDKHRHKQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDS 78

  Fly   882 N--DDNKARRKPLTLALA---------------------QNHNNNQNGSQPTPSSATILNGTVAK 923
            :  ..:..:.:..||:|:                     |..:.:.........|..:..|...:
  Fly    79 STLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYR 143

  Fly   924 PSKV--------------------------YLYIQMQLCRKESLRDWLRDNRSETRAAHIGD--I 960
            ..::                          .||:||:||| |||..:|      .|...|.:  |
  Fly   144 AERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-ESLEQYL------LRCQRIPEERI 201

  Fly   961 FHQIVD---AVDYVHLKGLIHRDLKPSNIFFSQDGQ-IKIGDFGLVTDMADIPNLVAKCGDQSGL 1021
            :|.::|   .:..:|.:.|||.|:|..|:...:|.: .|:.|||||.|:           |::. 
  Fly   202 WHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDV-----------DRAN- 254

  Fly  1022 PSCARHTQQVGTHLYMSPEQLLGQHYDYKVDIYSLGLIFFELHVYFSTEMERIKTLRSLRDGQYP 1086
                .|....|...||:||.|.| |:....||:|||:...||..|....... .....||.|..|
  Fly   255 ----SHHATEGDSRYMAPEILQG-HFSKAADIFSLGIAMLELACYMDLPSNG-PLWHELRHGILP 313

  Fly  1087 KDF--AVNYPQQYDLLQQMLSAQPEQRPQTKQLKSQLRNILQLPHL--LSEGQSEQAELAERARR 1147
            ::|  .::...| .:::.|:...|.|||..:||.|.       |.|  |.:.:......:..:|.
  Fly   314 EEFINKISLELQ-SVIKSMMKPDPAQRPTAEQLLSH-------PKLQYLQKKRKSLMNFSMLSRS 370

  Fly  1148 LSRSR 1152
            ..|||
  Fly   371 FRRSR 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEKNP_649538.1 Luminal_EIF2AK3 73..401 CDD:188874
PKc_like 635..1113 CDD:304357 81/352 (23%)
S_TKc <925..1118 CDD:214567 61/226 (27%)
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 66/281 (23%)
Pkinase 102..349 CDD:278497 66/279 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11042
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.