DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CKL2

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_177415.1 Gene:CKL2 / 843603 AraportID:AT1G72710 Length:465 Species:Arabidopsis thaliana


Alignment Length:299 Identity:166/299 - (55%)
Similarity:219/299 - (73%) Gaps:6/299 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHVK 128
            |..|:||.::||.|||||::....::.:|:||||||:...|||.|..|:::|.:||||.|:|:||
plant     5 VGNKFRLGRKIGGGSFGEIYLGTNIQTNEEVAIKLENVKTKHPQLLYESKLYKVLQGGTGVPNVK 69

  Fly   129 HYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNF 193
            .|..||.|||:|:|||||:||||.|.|||..|:||.||||||::.|:|.:|::.|:|||||||||
plant    70 WYGVEGDYNVLVIDLLGPSLEDLFNFCSRKLSLKTVLMLADQMINRIEFVHQKSFLHRDIKPDNF 134

  Fly   194 LMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDLESV 257
            ||||.|...|||:|||||||| |.....:||.|.||::|.|||||||:..|.. ||||||||||:
plant   135 LMGLGRRANQVYVIDFGLAKK-YRDSNHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESL 198

  Fly   258 GYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKP 322
            |::|:||.:|.|||||::|.::.||||||:|.|.:..::.||.|.|.||..|..|||.|.|.:||
plant   199 GFVLMYFLKGSLPWQGLKAGNKKQKYEKISEKKVSTSIEALCRGYPSEFASYFHYCRSLRFDDKP 263

  Fly   323 DYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQ 361
            ||.||::||:.||..:....|::|||.:||    .||||
plant   264 DYAYLKRLFRDLFIREGFQFDYVFDWTILK----YQQSQ 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 151/264 (57%)
SPS1 67..>306 CDD:223589 137/239 (57%)
CKL2NP_177415.1 STKc_CK1_delta_epsilon 8..281 CDD:271027 155/273 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.