DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and ckl12

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_680447.1 Gene:ckl12 / 835804 AraportID:AT5G57015 Length:435 Species:Arabidopsis thaliana


Alignment Length:418 Identity:181/418 - (43%)
Similarity:245/418 - (58%) Gaps:63/418 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHVK 128
            |..||||.::||:|||||::....::.:|:||||||:...|||.|..|:::|.|||||.|:|::|
plant     5 VGNKYRLGRKIGSGSFGEIYLGTHIQTNEEVAIKLENVKTKHPQLLYESKLYRILQGGTGVPNIK 69

  Fly   129 HYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDNF 193
            .:..||.||.:|||||||:||||.|.|||..|:|:.||||||::.|||..|.:.|:|||:|||||
plant    70 WFGVEGDYNTLVMDLLGPSLEDLFNFCSRKLSLKSVLMLADQMINRVEYFHSKSFLHRDLKPDNF 134

  Fly   194 LMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDLESV 257
            ||||.|...||::||||||||:....|.:||.|.||::|.|||||||:..|.. ||||||||||:
plant   135 LMGLGRRANQVHIIDFGLAKKYRDNTTHQHIPYRENKNLTGTARYASMNTHLGIEQSRRDDLESL 199

  Fly   258 GYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEKP 322
            ||:|:||.:|.|||||::|.::.||||:|:|.|.:..::.||.|.|.||..|..|||.|.|.:||
plant   200 GYILMYFLKGSLPWQGLKAGTKKQKYERISEKKVSTSIESLCRGYPSEFASYFHYCRSLRFDDKP 264

  Fly   323 DYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQ-----QKGRERDRGGKRNVVVQKERH 382
            ||.||:::|:.||..:....|::|||.:||    .||||     .:|......|           
plant   265 DYGYLKRIFRDLFIREGFQFDYVFDWTILK----YQQSQLTAPPSRGLVSPAVG----------- 314

  Fly   383 RNKDRDSDTQRCRIKNGGDLLEIEENESTTGEDPNEDKPQKKHGKACSCSYHLQKKRLQDRDRRA 447
                                       ::.|..|......:..|              ::...|.
plant   315 ---------------------------TSAGLPPGLTSIDRYGG--------------EEEGGRP 338

  Fly   448 PLMTERRILSGEQEQELELELRGSPQMP 475
            |:.:.||.:||..|....|..|| |.||
plant   339 PMDSSRRRMSGALENSGNLSSRG-PMMP 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 149/264 (56%)
SPS1 67..>306 CDD:223589 135/239 (56%)
ckl12NP_680447.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 152/273 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.