DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and ckl8

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_199146.1 Gene:ckl8 / 834350 AraportID:AT5G43320 Length:480 Species:Arabidopsis thaliana


Alignment Length:368 Identity:179/368 - (48%)
Similarity:239/368 - (64%) Gaps:41/368 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHV 127
            :|.|||:|.:::|:|||||||....::..|:||:|||.:..:||.|..|:::|.:||||.||||:
plant     4 VVGGKYKLGRKLGSGSFGELFLGVNVQTGEEVAVKLEPARARHPQLHYESKLYMLLQGGTGIPHL 68

  Fly   128 KHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDN 192
            |.|..||.||.||:|||||::|||.|.|||.|::||.||||||::.|||.:|.|.|:||||||||
plant    69 KWYGVEGEYNCMVIDLLGPSMEDLFNYCSRRFNLKTVLMLADQMINRVEYMHVRGFLHRDIKPDN 133

  Fly   193 FLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDLES 256
            |||||.|...|||:||:|||||:..|:|.:||.|.||::|.||||||||..|.. ||||||||||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   257 VGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEK 321
            :||:|:||.||.|||||:||.::.|||:||:|.|...|::.||...|.||..|..|.|.|.|.:|
plant   199 LGYVLMYFLRGSLPWQGLRAGTKKQKYDKISEKKRLTPVEVLCKSFPPEFTSYFLYVRSLRFEDK 263

  Fly   322 PDYVYLQQLFKVLFRNQYKVCDFLFDWVVLK----------------------------RESPEQ 358
            |||.||::||:.||..:....|::|||.:||                            .|.|::
plant   264 PDYPYLKRLFRDLFIREGYQFDYVFDWTILKYPQFSSGSSSSSKPRSSLRPAMNPPVPIAERPDK 328

  Fly   359 QSQQKGRE-RD-----------RGGKRNVVVQKERHRNKDRDS 389
            .|...|:: ||           |.|..:.|||.:|.|.:..::
plant   329 PSAGAGQDSRDRFSGALEAYARRNGSGSGVVQADRSRPRTSEN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 154/264 (58%)
SPS1 67..>306 CDD:223589 141/239 (59%)
ckl8NP_199146.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 158/273 (58%)
Pkinase 9..244 CDD:278497 139/234 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.