DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and ckl4

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_194615.2 Gene:ckl4 / 829007 AraportID:AT4G28860 Length:414 Species:Arabidopsis thaliana


Alignment Length:324 Identity:160/324 - (49%)
Similarity:216/324 - (66%) Gaps:1/324 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIP 125
            |.|:.|||:|.::||.|||||:|.|..:...|.||:|:|:|..|||.|..||::|..|:||.|||
plant     2 ERIIGGKYKLGRKIGGGSFGEIFLATHIDTFEIVAVKIENSKTKHPQLLYEAKLYRTLEGGSGIP 66

  Fly   126 HVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            .::.:..:|..|.:|||||||:||||...|.|.||.||.||||||:|.|:|.:|.:.::||||||
plant    67 RIRWFGVDGTENALVMDLLGPSLEDLFVYCGRKFSPKTVLMLADQMLTRIEYVHSKGYLHRDIKP 131

  Fly   191 DNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDL 254
            |||||||.|...|||:|||||||::....|.:||.|.||::|.|||||||...|.. ||.|||||
plant   132 DNFLMGLGRKANQVYLIDFGLAKRYRDANTNRHIPYRENKNLTGTARYASCNTHLGIEQGRRDDL 196

  Fly   255 ESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFA 319
            ||:||:||||.||.|||||::|..:.|||:||.|.|.:.|::.||...||||..|..||..|.|.
plant   197 ESLGYVLLYFLRGSLPWQGLKAVDKKQKYDKICEKKISTPIEVLCKSHPVEFASYFHYCHTLTFD 261

  Fly   320 EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQQKGRERDRGGKRNVVVQKERHR 383
            ::|||.:|::||:.||..:....|:::||.::|.:..::...|..........|.:.:....||
plant   262 QRPDYGFLKRLFRDLFSREGYEFDYIYDWTIIKYQQSQKTRSQSQAVPGSSNARAIPMDTSNHR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 145/264 (55%)
SPS1 67..>306 CDD:223589 134/239 (56%)
ckl4NP_194615.2 PKc_like 8..282 CDD:419665 149/273 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3139
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.790

Return to query results.
Submit another query.