DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CKL6

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_567812.1 Gene:CKL6 / 828972 AraportID:AT4G28540 Length:479 Species:Arabidopsis thaliana


Alignment Length:414 Identity:186/414 - (44%)
Similarity:250/414 - (60%) Gaps:21/414 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHV 127
            ::.||::|.::||.|||||||.|..|:..|:.|:|||.:..|||.|..|::||.:||||.|||.:
plant     8 VIGGKFKLGRKIGGGSFGELFLAVSLQTGEEAAVKLEPAKTKHPQLHYESKIYMLLQGGSGIPSL 72

  Fly   128 KHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDN 192
            |.:..:|.||.||:|||||:||||.|.|:|..::|..||||||:::|||.:|.|.|:||||||||
plant    73 KWFGVQGDYNAMVIDLLGPSLEDLFNYCNRRLTLKAVLMLADQLISRVEYMHSRGFLHRDIKPDN 137

  Fly   193 FLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHY-AEQSRRDDLES 256
            |||||.|...|||:||||||||:..|:|.:||.|.||::|.||||||||..|. .||||||||||
plant   138 FLMGLGRKANQVYIIDFGLAKKYRDLQTHRHIPYRENKNLTGTARYASVNTHLGVEQSRRDDLES 202

  Fly   257 VGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEK 321
            :||:|:||.||.|||||::|.::.|||::|:|.|.:.|::.||...|.||..|.:|||.|.|.:|
plant   203 LGYVLMYFLRGSLPWQGLKAGTKKQKYDRISEKKVSTPIEVLCKSYPPEFVSYFQYCRSLRFEDK 267

  Fly   322 PDYVYLQQLFKVLFRNQYKVCDFLFDWVVLKRESPEQQSQQKGRERDRGGKRNVVVQKERHRNKD 386
            |||.||::||:.||..:....|::|||..||......:|.....||.|.||..:.......:   
plant   268 PDYSYLKRLFRDLFIREGYQFDYVFDWTALKHPQSSARSHSSTHERHRTGKPGMGAGPSAEK--- 329

  Fly   387 RDSDTQRCRIKNGGD----LLEIEENESTTGEDPNEDK---------PQKKHGKACSCSYHLQKK 438
                .:|..:.|..|    .:|.....:..|..|:::.         |..|..............
plant   330 ----PERISVGNIRDKFSGAVEAFARRNVRGPSPHQNHTRHRTLDEIPSMKPAVNMVSEKGRNTS 390

  Fly   439 RLQDRDRRAPLMTERRILSGEQEQ 462
            |.....|||.....|...||||.:
plant   391 RYGSASRRAVASGSRPSSSGEQRE 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 152/264 (58%)
SPS1 67..>306 CDD:223589 138/239 (58%)
CKL6NP_567812.1 STKc_CK1_delta_epsilon 12..286 CDD:271027 156/273 (57%)
PHA03307 302..>471 CDD:223039 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3139
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.780

Return to query results.
Submit another query.