DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and CKI1

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_193170.1 Gene:CKI1 / 827076 AraportID:AT4G14340 Length:457 Species:Arabidopsis thaliana


Alignment Length:478 Identity:196/478 - (41%)
Similarity:271/478 - (56%) Gaps:80/478 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 EKDQRQDRRFSEEKQSLPEIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPL 107
            :::|:.|.            ::.||::|.:::|:||||||:....::..|:||:|||....:||.
plant     2 DRNQKMDH------------VIGGKFKLGRKLGSGSFGELYLGINIQTGEEVAVKLEPVKTRHPQ 54

  Fly   108 LPREARIYGILQGGLGIPHVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQIL 172
            |..|::||..||||.|:||:|.:..||.|:.||:|||||:||||.|.|.|.||:|:.||||||::
plant    55 LQYESKIYMFLQGGTGVPHLKWFGVEGEYSCMVIDLLGPSLEDLFNYCKRIFSLKSVLMLADQLI 119

  Fly   173 ARVELLHRRCFIHRDIKPDNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTAR 237
            .|||.:|.|.|:|||||||||||||.|...|||:||:|||||:..|:|||||.|.||::|.||||
plant   120 CRVEYMHSRGFLHRDIKPDNFLMGLGRRANQVYIIDYGLAKKYKDLQTQKHIPYRENKNLTGTAR 184

  Fly   238 YASVRAHYA-EQSRRDDLESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSG 301
            ||||..|.. ||||||||||:||:|:||.||.|||||::|.::.|||:||:|.|....::.||..
plant   185 YASVNTHLGIEQSRRDDLESLGYVLMYFLRGSLPWQGLKAGTKKQKYDKISEKKMLTSVETLCKS 249

  Fly   302 LPVEFFMYLKYCRKLHFAEKPDYVYLQQLFKVLF-RNQYKVCDFLFDWVVLK----------RES 355
            .|.||..|..|||.|.|.:||||.||::||:.|| |..|:: |::|||.:.|          |.:
plant   250 YPSEFTSYFHYCRSLRFEDKPDYSYLRRLFRDLFIREGYQL-DYVFDWTISKYPQIGSSSRPRPT 313

  Fly   356 PEQQSQQKGRERDRGGK--------------------RNVVVQ-----KERHRNKD--------- 386
            |.......|...:|..|                    |||..|     :.|||:.|         
plant   314 PRPALDPPGPPAERAEKPTVGQDLRGRFTGAIEAFTRRNVSSQGALGDRSRHRSSDDIPSSAKEV 378

  Fly   387 ---RDSDTQRCRIKNG---GDLLEIEENEST------TGEDPNEDKPQKKHGKACSCSYHLQKKR 439
               |:..|.:..:.:.   |...|..||.|:      :.....:..||.....|.:...|     
plant   379 HESRNGSTSKRGVISSTRPGSSAEPSENHSSRLFSSGSRHATTQRVPQSYESAAAARPGH----- 438

  Fly   440 LQDRDRRAPLMTERRILSGEQEQ 462
             :|..|...|:|   |.||::.:
plant   439 -EDAIRNFELLT---IGSGKKRK 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 151/264 (57%)
SPS1 67..>306 CDD:223589 137/239 (57%)
CKI1NP_193170.1 STKc_CK1_delta_epsilon 14..288 CDD:271027 156/273 (57%)
PHA03307 <305..>436 CDD:223039 23/130 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3139
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.