DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and AT4G08800

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_192620.1 Gene:AT4G08800 / 826451 AraportID:AT4G08800 Length:285 Species:Arabidopsis thaliana


Alignment Length:293 Identity:133/293 - (45%)
Similarity:186/293 - (63%) Gaps:33/293 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EIIVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIP 125
            |:.:..|:||.::||:|:|||::....::.:|.||||.||....||.|..|:|||.:||.|.|||
plant     2 ELRIGNKFRLGRKIGSGAFGEIYLGTDVQSNEDVAIKFESVKTVHPQLAYESRIYRVLQSGNGIP 66

  Fly   126 HVKHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKP 190
            ::|.|.                          .||:||.||||||::.|:|.:|.:.|:||||||
plant    67 NMKWYG--------------------------KFSLKTVLMLADQMINRLEFIHSKSFLHRDIKP 105

  Fly   191 DNFLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDL 254
            ||||||      :....|||||:|:....:.:||.|.||:.|.||..|||:..|.. |||||||:
plant   106 DNFLMG------KAGKSDFGLARKYRDSSSYRHIPYRENKSLTGTPAYASLNTHLGIEQSRRDDV 164

  Fly   255 ESVGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFA 319
            ||:||:|:||.:|.|||:|::|.::.|||:||:|.|.:..::.||.|.|:||..|:.|||.|.|.
plant   165 ESLGYILMYFLKGSLPWKGLKAGNKKQKYDKISEKKVSTSIETLCEGHPIEFATYIHYCRSLRFD 229

  Fly   320 EKPDYVYLQQLFKVLFRNQYKVCDFLFDWVVLK 352
            :||||.||::||:.||..:....||:|||.|||
plant   230 DKPDYAYLKRLFRDLFIREGFQFDFVFDWTVLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 120/264 (45%)
SPS1 67..>306 CDD:223589 106/239 (44%)
AT4G08800NP_192620.1 PKc_like 8..250 CDD:304357 124/273 (45%)
SPS1 8..>205 CDD:223589 102/228 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.