DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and ckl10

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_188976.1 Gene:ckl10 / 821915 AraportID:AT3G23340 Length:442 Species:Arabidopsis thaliana


Alignment Length:332 Identity:174/332 - (52%)
Similarity:231/332 - (69%) Gaps:12/332 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 IVAGKYRLLKRIGNGSFGELFQAEGLKYHEKVAIKLESSTVKHPLLPREARIYGILQGGLGIPHV 127
            ::.||::|.::||:||||||:....::..|:||:|||....|||.|..|:::|.:||||.|:||:
plant     4 VIGGKFKLGRKIGSGSFGELYIGINVQTGEEVALKLEPVKTKHPQLHYESKVYMLLQGGTGVPHI 68

  Fly   128 KHYATEGAYNVMVMDLLGPTLEDLLNLCSRSFSMKTTLMLADQILARVELLHRRCFIHRDIKPDN 192
            |.:..||.||.|.:|||||:||||.|.|:||||:||.||||||::.|||.:|.|.|:||||||||
plant    69 KWFGVEGNYNCMAIDLLGPSLEDLFNYCTRSFSLKTVLMLADQLINRVEYMHSRGFLHRDIKPDN 133

  Fly   193 FLMGLNRHQTQVYMIDFGLAKKFYSLRTQKHIGYTENRDLVGTARYASVRAHYA-EQSRRDDLES 256
            |||||.|...|||:||:|||||:..|:|.|||.|.||::|.||||||||..|.. ||||||||||
plant   134 FLMGLGRKANQVYIIDYGLAKKYRDLQTHKHIPYRENKNLTGTARYASVNTHLGIEQSRRDDLES 198

  Fly   257 VGYLLLYFQRGRLPWQGIRAQSQAQKYEKIAEYKANIPLQQLCSGLPVEFFMYLKYCRKLHFAEK 321
            :||:|:||.||.|||||::|.::.||||||:|.|...|::.||...|.||..|..|||.|.|.:|
plant   199 LGYVLMYFIRGSLPWQGLKAGTKKQKYEKISEKKMLTPVEVLCKSYPSEFTSYFHYCRSLRFEDK 263

  Fly   322 PDYVYLQQLFKVLFRNQYKVCDFLFDWVVLK----------RESPEQQSQQKGRERDRGGKRNVV 376
            |||.||::||:.||..:....|::|||.:||          |.:|:......|...:| .::.:|
plant   264 PDYSYLKRLFRDLFIREGYQFDYVFDWTILKYPQSGSISKPRPNPKPALDPPGPSAER-NEKPIV 327

  Fly   377 VQKERHR 383
            .|..|.|
plant   328 GQDLRER 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 155/264 (59%)
SPS1 67..>306 CDD:223589 141/239 (59%)
ckl10NP_188976.1 STKc_CK1_delta_epsilon 8..282 CDD:271027 159/273 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54222
OrthoDB 1 1.010 - - D1097975at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.