DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12147 and Vrk3

DIOPT Version :9

Sequence 1:NP_649536.1 Gene:CG12147 / 40651 FlyBaseID:FBgn0037325 Length:477 Species:Drosophila melanogaster
Sequence 2:NP_001005561.2 Gene:Vrk3 / 361565 RGDID:1549692 Length:462 Species:Rattus norvegicus


Alignment Length:274 Identity:73/274 - (26%)
Similarity:117/274 - (42%) Gaps:39/274 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GELFQAEGLKYHEKVAIKLESSTVKH----PLLPREARIYGILQGGLGIPHVKHYATEGAYNVMV 140
            |.||..:  .:.::.|..|:.:..|.    |||.....|      |.|:...|       |..:|
  Rat   197 GRLFNEQ--NFFQRAAKPLQVNKWKKRCLTPLLAIPTCI------GFGVHQDK-------YRFLV 246

  Fly   141 MDLLGPTLEDLLNLCSRS-FSMKTTLMLADQILARVELLHRRCFIHRDIKPDNFLMGLNRHQTQV 204
            ...||.:|:..|:...:. .|.:..|.:|.::|..:|.||...::|.::..:|..:. ....:||
  Rat   247 FPSLGRSLQSALDDNPKHVVSERCMLQVACRLLDALEYLHEHEYVHGNLTTENVFVN-PEDLSQV 310

  Fly   205 YMIDFGLAKKFYSLRTQKHIGYTE-NRDL-VGTARYASVRAHY-AEQSRRDDLESVGYLLLYFQR 266
            .::.:|...::  ....||:.|.| :|.| .|...:.|:..|. ...|||.||:::||.:|.:..
  Rat   311 TLVGYGFTYRY--CPGGKHVAYKEGSRSLHDGDLEFISMDVHKGCGPSRRSDLQTLGYCMLKWLY 373

  Fly   267 GRLPWQGI-----RAQSQAQKYEKIAEYKANIPLQQLC---SGLPVEFFMYLKYCRKLHFAEKPD 323
            |.|||...     ....|.|||:...|     ||..||   :........|||....|.:.|||.
  Rat   374 GSLPWTNCLPNTEEITKQKQKYQDNPE-----PLVGLCGRWNKTSETLREYLKVVMALDYEEKPP 433

  Fly   324 YVYLQQLFKVLFRN 337
            |..|:...:||.:|
  Rat   434 YATLRNNLEVLLQN 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12147NP_649536.1 STKc_CK1 67..331 CDD:270918 70/266 (26%)
SPS1 67..>306 CDD:223589 61/241 (25%)
Vrk3NP_001005561.2 zinc_ribbon_2 13..35 CDD:289981
DZR 14..>38 CDD:289539
PKc_like 143..445 CDD:304357 71/270 (26%)
SPS1 229..>458 CDD:223589 64/240 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1164
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.